Anti-PVRL4/NECTIN4 Antibody Picoband™ | Boster PB10091 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-PVRL4/NECTIN4 Antibody Picoband™

catalog :

PB10091

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot

product information

SKU :

PB10091

Product Name :

Anti-PVRL4/NECTIN4 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml, Human.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-PVRL4/NECTIN4 Antibody Picoband™ catalog # PB10091. Tested in WB applications. This antibody reacts with Human.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

NECTIN4

Uniprot ID :

Q96NY8

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human Nectin-4/PVRL4 (53-94aa FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGL HVSPAY), different from the related mouse sequence by seven amino acids.

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Nectin-4

Synonyms :

Nectin-4; Ig superfamily receptor LNIR; Nectin cell adhesion molecule 4 ; Poliovirus receptor-related protein 4; Processed poliovirus receptor-related protein 4; NECTIN4 ; LNIR, PRR4, PVRL4;

Protein Name :

Nectin-4

Molecular Weight :

55454 MW

Protein Function :

Seems to be involved in cell adhesion through trans- homophilic and -heterophilic interactions, the latter including specifically interactions with NECTIN1. Does not act as receptor for alpha-herpesvirus entry into cells.

Subcellular Localization :

Cell membrane ; Single-pass type I membrane protein. Cell junction, adherens junction. Colocalizes with MLLT4 at cadherin-based adherens junctions (PubMed:11544254).

Tissue Specificity :

Predominantly expressed in placenta. Not detected in normal breast epithelium but expressed in breast carcinoma.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

PVRL4, also known as Nectin-4, is expressed in human skin, hair follicles, and cultured keratinocytes, but not in fibroblasts. This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.