This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband™
catalog :
PB10088
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, rat
application :
western blot
product information
SKU :
PB10088
Product Name :
Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Rat
Predicted Reactivity :
Bovine, Canine, Hamster, Horse, Monkey, Rabbit
Application(s) :
WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human, Rat.
Application Notes :
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-Proteasome 20S alpha 2/PSMA2 Antibody Picoband™ catalog # PB10088. Tested in WB applications. This antibody reacts with Human, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
PSMA2
Uniprot ID :
P25787
Immunogen :
Q), identical to the related mouse and rat sequences.
DYRVLVHRARKLAQQYYLVYQEPIPTAQLVQRVASVMQE
YT
A synthetic peptide corresponding to a sequence in the middle region of human PSMA2 (82-123aa
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Proteasome subunit alpha type-2
Synonyms :
Proteasome subunit alpha type-2; 3.4.25.1; Macropain subunit C3; Multicatalytic endopeptidase complex subunit C3; Proteasome component C3; PSMA2; HC3, PSC3;
Protein Name :
Proteasome subunit alpha type-2
Molecular Weight :
25899 MW
Protein Function :
The proteasome is a multicatalytic proteinase complex which is characterized by its ability to cleave peptides with Arg, Phe, Tyr, Leu, and Glu adjacent to the leaving group at neutral or slightly basic pH. The proteasome has an ATP-dependent proteolytic activity. PSMA2 may have a potential regulatory effect on another component (s) of the proteasome complex through tyrosine phosphorylation.
Subcellular Localization :
Cytoplasm. Nucleus. Cytoplasm, P-body. Colocalizes with TRIM5 in the cytoplasmic bodies.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
Proteasome subunit alpha type-2 is a protein that in humans is encoded by the PSMA2 gene. The proteasome is a multicatalytic proteinase complex with a highly ordered ring-shaped 20S core structure. The core structure is composed of 4 rings of 28 non-identical subunits; 2 rings are composed of 7 alpha subunits and 2 rings are composed of 7 beta subunits. Proteasomes are distributed throughout eukaryotic cells at a high concentration and cleave peptides in an ATP/ubiquitin-dependent process in a non-lysosomal pathway. An essential function of a modified proteasome, the immunoproteasome, is the processing of class I MHC peptides. This gene encodes a member of the peptidase T1A family, that is a 20S core alpha subunit.
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits