Anti-EpCAM Antibody Picoband™ | Boster PB10059 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-EpCAM Antibody Picoband™

catalog :

PB10059

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, ELISA, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

SKU :

PB10059

Product Name :

Anti-EpCAM Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human

Application(s) :

ELISA, Flow Cytometry, IF, IHC-P, WB

Application Details :

Western blot, 0.1-0.5µg/ml. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, By Heat. Immunofluorescence, 2.5µg/ml. Flow Cytometry, 1-3μg/1x10^6cells. ELISA, 0.1-0.5µg/ml.

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-EpCAM Antibody Picoband™ catalog # PB10059. Tested in ELISA, Flow Cytometry, IF, IHC-P, WB applications. This antibody reacts with Human.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

EPCAM

Uniprot ID :

P16422

Immunogen :

different from the related mouse sequence by fifteen amino acids, and from the related rat sequence by sixteen ami
ELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSIL
YENN),
A synthetic peptide corresponding to a sequence in the middle region of human EPCAM (147-189aa

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Epithelial cell adhesion molecule

Synonyms :

Epithelial cell adhesion molecule; Ep-CAM; Adenocarcinoma-associated antigen; Cell surface glycoprotein Trop-1; Epithelial cell surface antigen; Epithelial glycoprotein; EGP; Epithelial glycoprotein 314; EGP314; hEGP314; KS 1/4 antigen; KSA; Major gastrointestinal tumor-associated protein GA733-2; Tumor-associated calcium signal transducer 1; CD326; EPCAM; GA733-2, M1S2, M4S1, MIC18, TACSTD1, TROP1;

Protein Name :

Epithelial cell adhesion molecule

Molecular Weight :

34932 MW

Protein Function :

May act as a physical homophilic interaction molecule between intestinal epithelial cells (IECs) and intraepithelial lymphocytes (IELs) at the mucosal epithelium for providing immunological barrier as a first line of defense against mucosal infection. Plays a role in embryonic stem cells proliferation and differentiation. Up-regulates the expression of FABP5, MYC and cyclins A and E.

Subcellular Localization :

Lateral cell membrane ; Single-pass type I membrane protein. Cell junction, tight junction. Colocalizes with CLDN7 at the lateral cell membrane and tight junction.

Tissue Specificity :

Highly and selectively expressed by undifferentiated rather than differentiated embryonic stem cells (ESC). Levels rapidly diminish as soon as ESC's differentiate (at protein levels). Expressed in almost all epithelial cell membranes but not on mesodermal or neural cell membranes. Found on the surface of adenocarcinoma.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Background :

Epithelial cell adhesion molecule (EpCAM) is a transmembrane glycoprotein mediating Ca2+-independent homotypic cell–cell adhesion in epithelia. This gene encodes a carcinoma-associated antigen and is a member of a family that includes at least two type I membrane proteins. This antigen is expressed on most normal epithelial cells and gastrointestinal carcinomas and functions as a homotypic calcium-independent cell adhesion molecule. The antigen is being used as a target for immunotherapy treatment of human carcinomas. Mutations in this gene result in congenital tufting enteropathy.

Research Category :

Cell Type Markers, Tags & Cell Markers, Tumor Associated