This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-ACTN3 Antibody Picoband™
catalog :
PB10026
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, flow cytometry, immunohistochemistry - paraffin section
product information
SKU :
PB10026
Product Name :
Anti-ACTN3 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
Flow Cytometry, IHC-P, WB
Application Details :
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat.
Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.Flow Cytometry, 1-3μg/1x10^6 cells, Human.
Application Notes :
Tested Species: In-house tested species with positive results.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-ACTN3 Antibody Picoband™ catalog # PB10026. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
ACTN3
Uniprot ID :
Q08043
Immunogen :
K), different from the related mouse sequence by five amino acids.
EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQ
DINT
A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa
EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQ
DINT
A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Alpha-actinin-3
Synonyms :
Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3;
Protein Name :
Alpha-actinin-3
Molecular Weight :
103241 MW
Protein Function :
F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.
Tissue Specificity :
Expressed only in a subset of type 2 skeletal muscle fibers.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Background :
Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.
Research Category :
Actin Binding Proteins, Actin Etc, Cytoskeleton, Cytoskeleton / Ecm, Microfilaments, Signal Transduction
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments