Anti-Perilipin 3/PLIN3 Antibody Picoband™ | Boster PB10013 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Perilipin 3/PLIN3 Antibody Picoband™

catalog :

PB10013

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunohistochemistry

product information

SKU :

PB10013

Product Name :

Anti-Perilipin 3/PLIN3 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

IHC, WB

Application Details :

Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat. Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Perilipin 3/PLIN3 Antibody Picoband™ catalog # PB10013. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

PLIN3

Uniprot ID :

O60664

Immunogen :

RRQ), different from the related mouse sequence by fourteen amino acids.
ESRALTMFRDIAQQLQATCTSLGSSIQGLPTNVKDQVQQ
A
A synthetic peptide corresponding to a sequence at the C-terminus of human Perilipin 3 (323-365aa

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Perilipin-3

Synonyms :

Perilipin-3; 47 kDa mannose 6-phosphate receptor-binding protein; 47 kDa MPR-binding protein; Cargo selection protein TIP47; Mannose-6-phosphate receptor-binding protein 1; Placental protein 17; PP17; PLIN3; M6PRBP1, TIP47;

Protein Name :

Perilipin-3

Molecular Weight :

47075 MW

Protein Function :

Required for the transport of mannose 6-phosphate receptors (MPR) from endosomes to the trans-Golgi network.

Subcellular Localization :

Cytoplasm. Endosome membrane ; Peripheral membrane protein ; Cytoplasmic side. Lipid droplet. Membrane associated on endosomes. Detected in the envelope and the core of lipid bodies and in lipid sails.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Background :

Mannose-6-phosphate receptor binding protein 1 (M6PRBP1), also known as Perilipin 3 (PLN3) or TIP47, is a protein which in humans is encoded by the M6PRBP1 gene. Mannose 6-phophate receptors (MPRs) deliver lysosomal hydrolase from the Golgi to endosomes and then return to the Golgi complex. The protein encoded by this gene interacts with the cytoplasmic domains of both cation-independent and cation-dependent MPRs, and is required for endosome-to-Golgi transport. This protein also binds directly to the GTPase RAB9 (RAB9A), a member of the RAS oncogene family. The interaction with RAB9 has been shown to increase the affinity of this protein for its cargo. Multiple transcript variants encoding different isoforms have been found for this gene.

Research Category :

Golgi Proteins, Protein Trafficking, Signal Transduction