This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-CD18/ITGB2 Antibody
catalog :
PA1124
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
SKU :
PA1124
Product Name :
Anti-CD18/ITGB2 Antibody
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human
Application(s) :
WB
Application Details :
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat. Western blot, 0.1-0.5µg/ml, Human.
Application Notes :
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-CD18/ITGB2 Antibody catalog # PA1124. Tested in WB applications. This antibody reacts with Human.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
ITGB2
Uniprot ID :
P05107
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human CD18 (24-58aa, ECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPD), different from the related mouse sequence by five amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg Thimerosal, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Integrin beta-2
Synonyms :
Integrin beta-2; Cell surface adhesion glycoproteins LFA-1/CR3/p150,95 subunit beta; Complement receptor C3 subunit beta; CD18; ITGB2; CD18, MFI7;
Protein Name :
Integrin beta-2
Molecular Weight :
84782 MW
Protein Function :
Integrin alpha-L/beta-2 is a receptor for ICAM1, ICAM2, ICAM3 and ICAM4. Integrins alpha-M/beta-2 and alpha-X/beta-2 are receptors for the iC3b fragment of the third complement component and for fibrinogen. Integrin alpha-X/beta-2 recognizes the sequence G-P-R in fibrinogen alpha-chain. Integrin alpha-M/beta-2 recognizes P1 and P2 peptides of fibrinogen gamma chain. Integrin alpha-M/beta-2 is also a receptor for factor X. Integrin alpha- D/beta-2 is a receptor for ICAM3 and VCAM1. Triggers neutrophil transmigration during lung injury through PTK2B/PYK2-mediated activation.
Subcellular Localization :
Membrane; Single-pass type I membrane protein.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Sequence Similarities :
Belongs to the integrin beta chain family.
Background :
The beta-2 integrin chain gene is designated ITGB2 and the leukocyte antigen has been designated CD18. The 3 alpha integrin chains associated individually with the beta-2 chain as a heterodimer have gene designations of ITGAL, ITGAM, and ITGAX, and leukocyte antigen designations of CD11A, CD11B, and CD11C, respectively. The expression of CD18 was increased in lymphoblastoid cells from persons with Down syndrome, consistent with the location of the gene on chromosome 21. The ITGB2 gene spans approximately 40 kb and contains 16 exons and all exon/intron boundaries conform to the GT/AG splicing consensus. Furthermore, ITGB2 was constitutively clustered. Although it was expressed on the cell surface at normal levels and was capable of function following extracellular stimulation, it could not be activated via the “inside-out” signaling pathways.
Research Category :
Cell Adhesion, Cell Type Markers, Cytoskeleton / Ecm, Hematopoietic Progenitors, Immunology, Integrins, Myeloid, Signal Transduction, Stem Cells
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments