Anti-TCP1 alpha Antibody Picoband™ (monoclonal, 2E7)

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-TCP1 alpha Antibody Picoband™ (monoclonal, 2E7)

catalog :

M02389

quantity :

100µg/vial

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

20000000

reactivity :

human

application :

western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

SKU :

M02389

Product Name :

Anti-TCP1 alpha Antibody Picoband™ (monoclonal, 2E7)

Size :

100µg/vial

Clonality :

Monoclonal

Clone Number :

20000000

Host :

Mouse

Reactivity :

Human

Application(s) :

Flow Cytometry, IF, IHC-P, ICC, WB

Application Details :

Western blot, 0.1-0.5µg/ml. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml. Immunocytochemistry/Immunofluorescence, 2µg/ml. Flow Cytometry, 1-3μg/1x10^6 cells

Description :

Boster Bio Anti-TCP1 alpha Antibody Picoband™ (monoclonal, 2E7) catalog # M02389. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

TCP1

Uniprot ID :

P17987

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Cross-reactivity :

No cross reactivity with other proteins.

Isotype :

IgG1

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

t-complex 1

Synonyms :

T-complex protein 1 subunit alpha; TCP-1-alpha; CCT-alpha; TCP1; CCT1; CCTA

Protein Name :

T-complex protein 1 subunit alpha

Protein Function :

Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.

Subcellular Localization :

Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG (EK1001) for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit (SV0001-1) for IHC(P) and ICC.

Background :

T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.

Research Category :

Actin, Actin Etc, Chaperones, Cytoskeleton, Cytoskeleton / Ecm, Microfilaments, Protein Trafficking, Signal Transduction