Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7)

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7)

catalog :

M02389-Dyl550

quantity :

50 ug/vial

clonality :

monoclonal

host :

mouse

conjugate :

DyLight 550

clone name :

20000000

reactivity :

human

application :

flow cytometry

product information

SKU :

M02389-Dyl550

Product Name :

Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody(monoclonal, 2E7)

Size :

50 ug/vial

Clonality :

Monoclonal

Clone Number :

20000000

Host :

Mouse

Conjugate :

DyLight®550

Reactivity :

Human

Application(s) :

Flow Cytometry

Application Details :

Flow Cytometry, 1-3μg/1x10^6 cells

Description :

Boster Bio Anti-Human TCP1 alpha DyLight® 550 conjugated Antibody (monoclonal, 2E7) catalog # M02389-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.

Concentration :

0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.

Gene Name :

TCP1

Uniprot ID :

P17987

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human TCP1 alpha (515-551aa KFATEAAITILRIDDLIKLHPESKDDKHGSYEDAVHS), different from the related mouse sequence by one amino acid, and from the related rat sequence by two amino acids.

Form :

Liquid

Contents :

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

Cross-reactivity :

No cross reactivity with other proteins.

Isotype :

IgG1

Storage :

At 2-8?C for one year from date of receipt. Protect from light. Do not freeze.

Gene Full Name :

t-complex 1

Synonyms :

T-complex protein 1 subunit alpha; TCP-1-alpha; CCT-alpha; TCP1; CCT1; CCTA

Protein Function :

Molecular chaperone; assists the folding of proteins upon ATP hydrolysis. As part of the BBS/CCT complex may play a role in the assembly of BBSome, a complex involved in ciliogenesis regulating transports vesicles to the cilia. Known to play a role, in vitro, in the folding of actin and tubulin.

Subcellular Localization :

Cytoplasm. Cytoplasm, cytoskeleton, microtubule organizing center, centrosome.

Background :

T-complex protein 1 subunit alpha is a protein that in humans is encoded by the TCP1 gene. The protein encoded by this gene is a molecular chaperone that is a member of the chaperonin containing TCP1 complex (CCT), also known as the TCP1 ring complex (TRiC). This complex consists of two identical stacked rings, each containing eight different proteins. Unfolded polypeptides enter the central cavity of the complex and are folded in an ATP-dependent manner. The complex folds various proteins, including actin and tubulin. Alternate transcriptional splice variants of this gene, encoding different isoforms, have been characterized. In addition, three pseudogenes that appear to be derived from this gene have been found.

Research Category :

Actin, Actin Etc, Chaperones, Cytoskeleton, Cytoskeleton / Ecm, Microfilaments, Protein Trafficking, Signal Transduction