This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Cytokeratin 19 KRT19 Antibody Picoband™ (monoclonal, 3D4)
catalog :
M02101-2
quantity :
100µg/vial
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
3D4
reactivity :
human
application :
western blot, immunohistochemistry, immunocytochemistry
product information
SKU :
M02101-2
Product Name :
Anti-Cytokeratin 19 KRT19 Antibody Picoband™ (monoclonal, 3D4)
Size :
100µg/vial
Clonality :
Monoclonal
Clone Number :
3D4
Host :
Mouse
Reactivity :
Human
Application(s) :
IF, IHC, WB
Application Details :
Western blot, 0.1-0.5µg/ml. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml. Immunofluorescence, 2µg/ml
Description :
Boster Bio Anti-Cytokeratin 19 KRT19 Antibody Picoband™ (monoclonal, 3D4) catalog # M02101-2. Tested in IF, IHC, WB applications. This antibody reacts with Human.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
KRT19
Uniprot ID :
P08727
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Cytokeratin 19 (334-372aa QLAHIQALISGIEAQLGDVRADSERQNQEYQRLMDIKSR), different from the related mouse and rat sequences by nine amino acids.
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Cross-reactivity :
No cross reactivity with other proteins.
Isotype :
IgG1
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
keratin 19
Synonyms :
Keratin, type I cytoskeletal 19; Cytokeratin-19; CK-19; Keratin-19; K19; KRT19
Protein Function :
Involved in the organization of myofibers. Together with KRT8, helps to link the contractile apparatus to dystrophin at the costameres of striated muscle.
Tissue Specificity :
Expressed in a defined zone of basal keratinocytes in the deep outer root sheath of hair follicles. Also observed in sweat gland and mammary gland ductal and secretory cells, bile ducts, gastrointestinal tract, bladder urothelium, oral epithelia, esophagus, ectocervical epithelium (at protein level). Expressed in epidermal basal cells, in nipple epidermis and a defined region of the hair follicle. Also seen in a subset of vascular wall cells in both the veins and artery of human umbilical cord, and in umbilical cord vascular smooth muscle. Observed in muscle fibers accumulating in the costameres of myoplasm at the sarcolemma in structures that contain dystrophin and spectrin.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG (EK1001) for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit (SV0001-1) for IHC(P).
Background :
Keratin, type I cytoskeletal 19 is a protein that in humans is encoded by the KRT19 gene. The protein encoded by this gene is a member of the keratin family. It is specifically expressed in the periderm, the transiently superficial layer that envelops the developing epidermis. The type I cytokeratins are clustered in a region of chromosome 17q12-q21. Due to its high sensitivity, KRT19 is the most used marker for the RT-PCR-mediated detection of tumor cells disseminated in lymph nodes, peripheral blood, and bone marrow of breast cancer patients. Keratin 19 is often used together with keratin 8 and keratin 18 to differentiate cells of epithelial origin from hematopoietic cells in tests that enumerate circulating tumor cells in blood.
Research Category :
Class I, Cytoskeleton, Cytoskeleton / Ecm, Intermediate Filaments, Signal Transduction
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits