Anti-FH Antibody Picoband™ (monoclonal, 9D8) | Boster M02097 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-FH Antibody Picoband™ (monoclonal, 9D8)

catalog :

M02097

quantity :

100µg/vial

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

9D8

The same clone is also sold as:

Invitrogen: MA5-33010

reactivity :

human, mouse, rat

application :

western blot, immunocytochemistry, immunohistochemistry - paraffin section

product information

SKU :

M02097

Product Name :

Anti-FH Antibody Picoband™ (monoclonal, 9D8)

Size :

100µg/vial

Clonality :

Monoclonal

Clone Number :

9D8

Host :

Mouse

Reactivity :

Human, Monkey, Mouse, Rat

Application(s) :

IF, IHC-P, ICC, WB

Application Details :

Western blot, 0.1-0.5µg/ml. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml. Immunocytochemistry/Immunofluorescence, 5 µg/ml

Description :

Boster Bio Anti-FH Antibody Picoband™ (monoclonal, 9D8) catalog # M02097. Tested in IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

Uniprot ID :

P07954

Immunogen :

A synthetic peptide corresponding to a sequence of human FH (YDKAAKIAKTAH KNGSTLKETAIELGYLTAEQFDEWVKPKDMLGPK).

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Cross-reactivity :

No cross reactivity with other proteins.

Isotype :

IgG2a

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Gene Full Name :

fumarate hydratase

Synonyms :

Fumarate hydratase, mitochondrial; Fumarase; FH;

Protein Function :

Also acts as a tumor suppressor.

Subcellular Localization :

Isoform Mitochondrial: Mitochondrion.

Tissue Specificity :

Expressed in red blood cells; underexpressed in red blood cells (cytoplasm) of patients with hereditary non- spherocytic hemolytic anemia of unknown etiology.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG (EK1001) for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit (SV0001-1) for IHC(P) and ICC.

Background :

Fumarase (or fumaratehydratase) is an enzyme that catalyzes the reversible hydration/dehydration of fumarate to malate. Fumarase comes in two forms: mitochondrial and cytosolic. The mitochondrial isoenzyme is involved in the Krebs Cycle (also known as the Tricarboxylic Acid Cycle [TCA] or the Citric Acid Cycle), and the cytosolic isoenzyme is involved in the metabolism of amino acids and fumarate. Subcellular localization is established by the presence of a signal sequence on the amino terminus in the mitochondrial form, while subcellular localization in the cytosolic form is established by the absence of the signal sequence found in the mitochondrial variety. This enzyme participates in 2 metabolic pathways: citric acid cycle, reductive citric acid cycle (CO2 fixation), and is also important in renal cell carcinoma. Mutations in this gene have been associated with the development of leiomyomas in the skin and uterus in combination with renal cell carcinoma.