Anti-AIF/AIFM1 Antibody Picoband™ (monoclonal, 2I5) | Boster M01571-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-AIF/AIFM1 Antibody Picoband™ (monoclonal, 2I5)

catalog :

M01571-1

quantity :

100µg/vial

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2I5

reactivity :

human, mouse, rat

application :

western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

SKU :

M01571-1

Product Name :

Anti-AIF/AIFM1 Antibody Picoband™ (monoclonal, 2I5)

Size :

100µg/vial

Clonality :

Monoclonal

Clone Number :

2I5

Host :

Mouse

Reactivity :

Human, Mouse, Rat

Application(s) :

Flow Cytometry, IF, IHC-P, ICC, WB

Application Details :

Western blot, 0.1-0.5µg/ml. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml. Immunofluorescence, 2µg/ml. Immunocytochemistry/Immunofluorescence, 5µg/ml. Flow Cytometry, 1-3µg/1x10^6 cells.

Description :

Boster Bio Anti-AIF/AIFM1 Antibody Picoband™ (monoclonal, 2I5) catalog # M01571-1. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

AIFM1

Uniprot ID :

O95831

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human AIF (582-613aa FNRMPIARKIIKDGEQHEDLNEVAKLFNIHED), identical to the related mouse and rat sequences.

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Cross-reactivity :

No cross reactivity with other proteins.

Isotype :

IgG1

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500µg/ml.

Gene Full Name :

apoptosis-inducing factor, mitochondrion-associated, 1

Synonyms :

AIFM1 antibody AIFM1_HUMAN antibody Apoptosis inducing factor 1, mitochondrial antibody Apoptosis inducing factor antibody Apoptosis inducing factor, mitochondrion associated, 1 antibody Apoptosis-inducing factor 1 antibody CMTX4 antibody COXPD6 antibody Harlequin antibody Hq antibody mAIF antibody MGC111425 antibody MGC5706 antibody mitochondrial antibody Neuropathy, axonal motor-sensory, with deafness and mental retardation antibody neuropathy, axonal, motor-sensory with deafness and mental retardation (Cowchock syndrome) antibody PDCD 8 antibody PDCD8 antibody Programmed cell death 8 (apoptosis inducing factor) antibody Programmed cell death 8 antibody Programmed cell death 8 isoform 1 antibody Programmed cell death 8 isoform 2 antibody Programmed cell death 8 isoform 3 antibody Programmed cell death protein 8 antibody Programmed cell death protein 8 mitochondrial antibody Programmed cell death protein 8 mitochondrial precursor antibody Striatal apoptosis inducing factor antibody

Protein Name :

Apoptosis-inducing factor 1, mitochondrial

Protein Function :

Functions both as NADH oxidoreductase and as regulator of apoptosis. In response to apoptotic stimuli, it is released from the mitochondrion intermembrane space into the cytosol and to the nucleus, where it functions as a proapoptotic factor in a caspase-independent pathway. In contrast, functions as an antiapoptotic factor in normal mitochondria via its NADH oxidoreductase activity. The soluble form (AIFsol) found in the nucleus induces 'parthanatos' i.e. caspase-independent fragmentation of chromosomal DNA. Interacts with EIF3G, and thereby inhibits the EIF3 machinery and protein synthesis, and activates casapse-7 to amplify apoptosis. Plays a critical role in caspase-independent, pyknotic cell death in hydrogen peroxide-exposed cells. Binds to DNA in a sequence-independent manner.

Subcellular Localization :

Mitochondrion intermembrane space. Mitochondrion inner membrane. Nucleus. Cytoplasm. Perinuclear region.

Tissue Specificity :

Detected in muscle and skin fibroblasts (at protein level). Isoform 5 is frequently down-regulated in human cancers.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG (EK1001) for Western blot, and HRP Conjugated anti- Mouse IgG Super Vision Assay Kit (SV0001-1) for IHC(P) and ICC.

Background :

Apoptosis-inducing factor 1, mitochondrial, also known as AIF or PDCD8 is a protein that in humans is encoded by the AIFM1 gene. AIFM1 gene is mapped to Xq26.1 based on an alignment of the AIFM1 sequence with the genomic sequence. This gene encodes a flavoprotein essential for nuclear disassembly in apoptotic cells, and it is found in the mitochondrial intermembrane space in healthy cells. Induction of apoptosis results in the translocation of this protein to the nucleus where it affects chromosome condensation and fragmentation. In addition, this gene product induces mitochondria to release the apoptogenic proteins cytochrome c and caspase-9. Mutations in this gene cause combined oxidative phosphorylation deficiency 6, which results in a severe mitochondrial encephalomyopathy. A related pseudogene has been identified on chromosome 10.

Research Category :

Actin Binding Proteins, Actin Etc, Cytoskeleton, Cytoskeleton / Ecm, Microfilaments, Signal Transduction