Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7) | Boster M01567 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7)

catalog :

M01567

quantity :

100µg/vial

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

2H7

reactivity :

human, mouse, rat

application :

western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

SKU :

M01567

Product Name :

Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7)

Size :

100µg/vial

Clonality :

Monoclonal

Clone Number :

2H7

Host :

Mouse

Reactivity :

Human, Mouse, Rat

Application(s) :

Flow Cytometry, IF, IHC-P, ICC, WB

Application Details :

Western blot, 0.1-0.5µg/ml. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml. Immunocytochemistry/Immunofluorescence, 2µg/ml. Flow Cytometry, 1-3µg/1x10^6 cells.

Description :

Boster Bio Anti-RPS6 Antibody Picoband™ (monoclonal, 2H7) catalog # M01567. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

RPS6

Uniprot ID :

P62753

Immunogen :

identical to the related mouse and rat sequences.
QKLIEVDDERKLRTFYEKRMATEVAADALGEEWKGYVVR
I),
A synthetic peptide corresponding to a sequence at the N-terminus of human RPS6 (13-52aa

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Cross-reactivity :

No cross reactivity with other proteins.

Isotype :

IgG1

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500µg/ml.

Gene Full Name :

ribosomal protein S6

Synonyms :

40S ribosomal protein S6; Phosphoprotein NP33; Small ribosomal subunit protein eS6; RPS6; OK/SW-cl.2

Protein Function :

May play an important role in controlling cell growth and proliferation through the selective translation of particular classes of mRNA.

Subcellular Localization :

Cytosol. Cytosolic small ribosomal subunit. Endoplasmic reticulum. Nucleus. Nucleoplasm. Nucleolus. Cell body. Cytoplasmic ribonucleoprotein granule. Dendrite. Membrane. Ribonucleoprotein complex. Small ribosomal subunit.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG (EK1001) for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit (SV0001-1) for IHC(P) and ICC.

Background :

Ribosomal protein S6 (rpS6) is a component of the 40S ribosomal subunit and is therefore thought to be involved in regulating translation. Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a cytoplasmic ribosomal protein that is a component of the 40S subunit. The protein belongs to the S6E family of ribosomal proteins. It is the major substrate of protein kinases in the ribosome, with subsets of five C-terminal serine residues phosphorylated by different protein kinases. Phosphorylation is induced by a wide range of stimuli, including growth factors, tumor-promoting agents, and mitogens. Dephosphorylation occurs at growth arrest. The protein may contribute to the control of cell growth and proliferation through the selective translation of particular classes of mRNA. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome. While the true function of rpS6 is currently under investigation, studies have shown that it is involved in the regulation of cell size, cell proliferation, and glucose homeostasis.

Research Category :

DNA / RNA, Epigenetics and Nuclear Signaling, Ribosome, Translation