This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-RPA70 RPA1 Antibody Picoband™ (monoclonal, 11H4)
catalog :
M01317-2
quantity :
100µg/vial
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
reactivity :
human, mouse
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry
product information
SKU :
M01317-2
Product Name :
Anti-RPA70 RPA1 Antibody Picoband™ (monoclonal, 11H4)
Size :
100µg/vial
Clonality :
Monoclonal
Clone Number :
11H4
Host :
Mouse
Reactivity :
Human, Monkey, Mouse
Application(s) :
Flow Cytometry, IF, IHC, WB
Application Details :
Western blot, 0.1-0.5µg/ml.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml.
Immunofluorescence, 2µg/ml.
Flow Cytometry, 1-3μg/1x10^6 cells.
Description :
Boster Bio Anti-RPA70 RPA1 Antibody Picoband™ (monoclonal, 11H4) catalog # M01317-2. Tested in Flow Cytometry, IF, IHC, WB applications. This antibody reacts with Human, Monkey, Mouse.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
RPA1
Uniprot ID :
P27694
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human RPA70 (533-568aa QESAEAILGQNAAYLGELKDKNEQAFEEVFQNANFR), different from the related mouse sequence by three amino acids.
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Cross-reactivity :
No cross reactivity with other proteins.
Isotype :
IgG2b
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Gene Full Name :
replication protein A1
Synonyms :
Replication protein A 70 kDa DNA-binding subunit; RP-A p70; Replication factor A protein 1; RF-A protein 1; Single-stranded DNA-binding protein; Replication protein A 70 kDa DNA-binding subunit, N-terminally processed; RPA1; REPA1; RPA70
Protein Function :
As part of the heterotrimeric replication protein A complex (RPA/RP-A), binds and stabilizes single-stranded DNA intermediates, that form during DNA replication or upon DNA stress. It prevents their reannealing and in parallel, recruits and activates different proteins and complexes involved in DNA metabolism (PubMed:27723720, PubMed:27723717). Thereby, it plays an essential role both in DNA replication and the cellular response to DNA damage (PubMed:9430682). In the cellular response to DNA damage, the RPA complex controls DNA repair and DNA damage checkpoint activation. Through recruitment of ATRIP activates the ATR kinase a master regulator of the DNA damage response (PubMed:24332808). It is required for the recruitment of the DNA double-strand break repair factors RAD51 and RAD52 to chromatin in response to DNA damage (PubMed:17765923). Also recruits to sites of DNA damage proteins like XPA and XPG that are involved in nucleotide excision repair and is required for this mechanism of DNA repair (PubMed:7697716). Plays also a role in base excision repair (BER) probably through interaction with UNG (PubMed:9765279). Also recruits SMARCAL1/HARP, which is involved in replication fork restart, to sites of DNA damage. May also play a role in telomere maintenance (PubMed:17959650). As part of the alternative replication protein A complex, aRPA, binds single- stranded DNA and probably plays a role in DNA repair. Compared to the RPA2-containing, canonical RPA complex, may not support chromosomal DNA replication and cell cycle progression through S- phase. The aRPA may not promote efficient priming by DNA polymerase alpha but could support DNA synthesis by polymerase delta in presence of PCNA and replication factor C (RFC), the dual incision/excision reaction of nucleotide excision repair and RAD51-dependent strand exchange (PubMed:19996105).
Subcellular Localization :
Nucleus
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG (EK1001) for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit (SV0001-1) for IHC(P).
Background :
Replication protein A 70 kDa DNA-binding subunit is a protein that in humans is encoded by the RPA1 gene. This gene is mapped to chromosome 17p13.3. Replication protein A (RPA) is a heterotrimeric single-strand DNA (ssDNA)-binding protein essential for DNA replication, repair, and recombination. It is composed of 70-kD (RPA1), 32-kD (RPA2), and 14-kD (RPA3) subunits. The RPA1 subunit is responsible for high-affinity ssDNA binding. The RPA complex was originally isolated as a factor essential for in vitro replication of the papovavirus SV40. It had been found that recombinant human RPA1, purified from bacteria, exhibited ssDNA-binding activity comparable to that of the complete RPA complex. RPA1 could substitute for the complete complex in stimulating the activity of DNA polymerase alpha-primase, but it could not substitute for the complete complex in SV40 DNA replication in vitro, suggesting an important functional role for the other subunits.
Research Category :
DNA / RNA, DNA Damage & Repair, DNA Damage Response, DNA Synthesis, Epigenetics and Nuclear Signaling
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments