Anti-Hsp90 alpha Antibody Picoband™ (monoclonal, 6B5) | Boster M01103-4 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Hsp90 alpha Antibody Picoband™ (monoclonal, 6B5)

catalog :

M01103-4

quantity :

100µg/vial

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

6B5

reactivity :

human

application :

western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

SKU :

M01103-4

Product Name :

Anti-Hsp90 alpha Antibody Picoband™ (monoclonal, 6B5)

Size :

100µg/vial

Clonality :

Monoclonal

Clone Number :

6B5

Host :

Mouse

Reactivity :

Human, Mouse, Rat, Monkey

Application(s) :

WB, IHC-P, ICC, IF, Flow Cytometry

Application Details :

Western blot, 0.25-0.5µg/ml, Human, Mouse, Rat, Monkey. Immunohistochemistry (Paraffin-embedded Section), 2-5µg/ml, Human. Immunocytochemistry/Immunofluorescence, 5µg/ml, Human. Flow Cytometry, 1-3μg/1x10^6 cells, Human.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Hsp90 alpha Antibody Picoband™ (monoclonal, 6B5) catalog # M01103-4. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

HSP90AA1

Uniprot ID :

P07900

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha (454-488aa QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQ), identical to the related mouse and rat sequences.

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Purification :

Immunogen affinity purified.

Isotype :

IgG2b

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and ICC.

Background :

Transgelin, also known as SM22 alpha, is a protein that in humans is encoded by the TAGLN gene. This gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The encoded protein is thought to be involved in calcium-independent smooth muscle contraction. It acts as a tumor suppressor, and the loss of its expression is an early event in cell transformation and the development of some tumors, coinciding with cellular plasticity. The encoded protein has a domain architecture consisting of an N-terminal calponin homology (CH) domain and a C-terminal calponin-like (CLIK) domain. Mice with a knockout of the orthologous gene are viable and fertile but their vascular smooth muscle cells exhibit alterations in the distribution of the actin filament and changes in cytoskeletal organization.