This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Hsp90 alpha Antibody Picoband™ (monoclonal, 6B5)
catalog :
M01103-4
quantity :
100µg/vial
clonality :
monoclonal
host :
mouse
conjugate :
nonconjugated
clone name :
6B5
reactivity :
human
application :
western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section
product information
SKU :
M01103-4
Product Name :
Anti-Hsp90 alpha Antibody Picoband™ (monoclonal, 6B5)
Size :
100µg/vial
Clonality :
Monoclonal
Clone Number :
6B5
Host :
Mouse
Reactivity :
Human, Mouse, Rat, Monkey
Application(s) :
WB, IHC-P, ICC, IF, Flow Cytometry
Application Details :
Western blot, 0.25-0.5µg/ml, Human, Mouse, Rat, Monkey. Immunohistochemistry (Paraffin-embedded Section), 2-5µg/ml, Human. Immunocytochemistry/Immunofluorescence, 5µg/ml, Human. Flow Cytometry, 1-3μg/1x10^6 cells, Human.
Application Notes :
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-Hsp90 alpha Antibody Picoband™ (monoclonal, 6B5) catalog # M01103-4. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
HSP90AA1
Uniprot ID :
P07900
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human Hsp90 alpha (454-488aa QNRKKLSELLRYYTSASGDEMVSLKDYCTRMKENQ), identical to the related mouse and rat sequences.
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
Purification :
Immunogen affinity purified.
Isotype :
IgG2b
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and ICC.
Background :
Transgelin, also known as SM22 alpha, is a protein that in humans is encoded by the TAGLN gene. This gene encodes a shape change and transformation sensitive actin-binding protein which belongs to the calponin family. It is ubiquitously expressed in vascular and visceral smooth muscle, and is an early marker of smooth muscle differentiation. The encoded protein is thought to be involved in calcium-independent smooth muscle contraction. It acts as a tumor suppressor, and the loss of its expression is an early event in cell transformation and the development of some tumors, coinciding with cellular plasticity. The encoded protein has a domain architecture consisting of an N-terminal calponin homology (CH) domain and a C-terminal calponin-like (CLIK) domain. Mice with a knockout of the orthologous gene are viable and fertile but their vascular smooth muscle cells exhibit alterations in the distribution of the actin filament and changes in cytoskeletal organization.
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits