Anti-GNAQ Antibody Picoband™ (monoclonal, 13H4) | Boster M00898 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-GNAQ Antibody Picoband™ (monoclonal, 13H4)

catalog :

M00898

quantity :

100µg/vial

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

13H4

The same clone is also sold as:

Invitrogen: MA5-49175

reactivity :

human

application :

western blot, flow cytometry, immunohistochemistry - paraffin section

product information

SKU :

M00898

Product Name :

Anti-GNAQ Antibody Picoband™ (monoclonal, 13H4)

Size :

100µg/vial

Clonality :

Monoclonal

Clone Number :

13H4

Host :

Mouse

Reactivity :

Human, Monkey, Mouse, Rat

Application(s) :

WB, IHC-P, Flow Cytometry

Application Details :

Western blot, 0.1-0.5µg/ml. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml. Flow Cytometry, 1-3µg/1x10^6 cells.

Description :

Boster Bio Anti-GNAQ Antibody Picoband™ (monoclonal, 13H4) catalog # M00898. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

GNAQ

Uniprot ID :

P50148

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human GNAQ (102-138aa KYEHNKAHAQLVREVDVEKVSAFENPYVDAIKSLWND), identical to the related mouse and rat sequences.

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Cross-reactivity :

No cross reactivity with other proteins.

Isotype :

IgG2b

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500µg/ml.

Gene Full Name :

guanine nucleotide binding protein (G protein), q polypeptide

Synonyms :

Guanine nucleotide-binding protein G (q) subunit alpha; Guanine nucleotide-binding protein alpha-q; GNAQ; GAQ

Protein Function :

Guanine nucleotide-binding proteins (G proteins) are involved as modulators or transducers in various transmembrane signaling systems. Regulates B-cell selection and survival and is required to prevent B-cell-dependent autoimmunity. Regulates chemotaxis of BM-derived neutrophils and dendritic cells.

Subcellular Localization :

Nucleus. Nucleus membrane. Membrane.

Tissue Specificity :

Predominantly expressed in ovary, prostate, testis and colon. Down-regulated in the peripheral blood lymphocytes (PBLs) of rheumatoid arthritis patients.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG (EK1001) for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit (SV0001-1) for IHC(P).

Background :

Guanine nucleotide-binding protein G (q) subunit alpha is a protein that in humans is encoded by the GNAQ gene. Guanine nucleotide-binding proteins are a family of heterotrimeric proteins that couple cell surface, 7-transmembrane domain receptors to intracellular signaling pathways. Receptor activation catalyzes the exchange of GDP for GTP bound to the inactive G protein alpha subunit resulting in a conformational change and dissociation of the complex. The G protein alpha and beta-gamma subunits are capable of regulating various cellular effectors. Activation is terminated by a GTPase intrinsic to the G-alpha subunit. G-alpha-q is the alpha subunit of one of the heterotrimeric GTP-binding proteins that mediates stimulation of phospholipase C-beta. Mutations in this gene have been found associated to cases of Sturge-Weber syndrome and port-wine stains.

Research Category :

Apoptosis, Cancer, Cardiovascular, G Protein Signaling, Heterotrimeric G Proteins, Neural Signal Transduction, Neurology Process, Neuroscience, Nucleotide Messenger, Second Messenger, Signal Transduction, Signaling Pathway, Small G Proteins