Anti-EWSR1 Antibody Picoband™ (monoclonal, 4B4) | Boster M00589 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-EWSR1 Antibody Picoband™ (monoclonal, 4B4)

catalog :

M00589

quantity :

100µg/vial

clonality :

monoclonal

host :

mouse

conjugate :

nonconjugated

clone name :

4B4

The same clone is also sold as:

Invitrogen: MA5-49161

reactivity :

human

application :

western blot, immunohistochemistry

product information

SKU :

M00589

Product Name :

Anti-EWSR1 Antibody Picoband™ (monoclonal, 4B4)

Size :

100µg/vial

Clonality :

Monoclonal

Clone Number :

4B4

Host :

Mouse

Reactivity :

Human, Monkey, Mouse

Application(s) :

IHC, WB

Application Details :

Western blot, 0.1-0.5µg/ml. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml.

Description :

Boster Bio Anti-EWSR1 Antibody Picoband™ (monoclonal, 4B4) catalog # M00589. Tested in IHC, WB applications. This antibody reacts with Human, Monkey, Mouse.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

EWSR1

Uniprot ID :

Q01844

Immunogen :

A synthetic peptide corresponding to a sequence in the middle region of human EWSR1 (369-399aa NDSVTLDDLADFFKQCGVVKMNKRTGQPMIH), different from the related mouse sequence by one amino acid.

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Cross-reactivity :

No cross reactivity with other proteins.

Isotype :

IgG2b

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Gene Full Name :

EWS RNA-binding protein 1

Synonyms :

RNA-binding protein EWS; EWS oncogene; Ewing sarcoma breakpoint region 1 protein; EWSR1; EWS

Protein Function :

Might normally function as a transcriptional repressor. EWS-fusion-proteins (EFPS) may play a role in the tumorigenic process. They may disturb gene expression by mimicking, or interfering with the normal function of CTD-POLII within the transcription initiation complex. They may also contribute to an aberrant activation of the fusion protein target genes.

Subcellular Localization :

Nucleus

Tissue Specificity :

Ubiquitous.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Mouse IgG (EK1001) for Western blot, and HRP Conjugated anti-Mouse IgG Super Vision Assay Kit (SV0001-1) for IHC(P).

Background :

This gene encodes a multifunctional protein that is involved in various cellular processes, including gene expression, cell signaling, and RNA processing and transport. The protein includes an N-terminal transcriptional activation domain and a C-terminal RNA-binding domain. Chromosomal translocations between this gene and various genes encoding transcription factors result in the production of chimeric proteins that are involved in tumorigenesis. These chimeric proteins usually consist of the N-terminal transcriptional activation domain of this protein fused to the C-terminal DNA-binding domain of the transcription factor protein. Mutations in this gene, specifically a t (11;22) (q24;q12) translocation, are known to cause Ewing sarcoma as well as neuroectodermal and various other tumors. Alternative splicing of this gene results in multiple transcript variants. Related pseudogenes have been identified on chromosomes 1 and 14.

Research Category :

Cancer Susceptibility, Cell Type Markers, Chromatin Binding Proteins, DNA / RNA Binding, Epigenetics and Nuclear Signaling, Proto-Oncogenes, Tags & Cell Markers, Transcription, Transcription Factors, Tumor Associated