Anti-Hepatitis B Virus Antibody Picoband™ | Boster A30379 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Hepatitis B Virus Antibody Picoband™

catalog :

A30379

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

application :

western blot, immunohistochemistry

product information

SKU :

A30379

Product Name :

Anti-Hepatitis B Virus Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human

Predicted Reactivity :

Hepatitis Virus

Application(s) :

IHC, WB

Application Details :

Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, By Heat. Western blot, 0.1-0.5µg/ml, HBV.

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Hepatitis B Virus Antibody Picoband™ catalog # A30379. Tested in IHC, WB applications. This antibody reacts with Human.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

Uniprot ID :

D2X4M3

Immunogen :

WSSKPRQGMGTNLSVPNPLGFFPDHQLDPAFGANSNNPD
WDFNPNKDQ).
A synthetic peptide corresponding to a sequence at the N-terminus of human Hepatitis B Virus (4-51aa

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

long surface protein; PreS1; L protein; LHBs; large S protein; pre-S1/pre-S2/S regions; L glycoprotein; L-HBsAG; LHBs

Synonyms :

Large S protein ; S ;

Protein Name :

Large S protein

Molecular Weight :

6374 MW

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Background :

Hepatitis B virus, abbreviated HBV, is a species of the genus Orthohepadnavirus, which is likewise a part of the Hepadnaviridae family of viruses. This virus causes the disease hepatitis B. It consists of HBsAg, HBcAg (HBeAg is a splice variant), Hepatitis B virus DNA polymerase and HBx. Among these, HBsAg (also known as the Australia antigen) is the surface antigen of the hepatitis B virus (HBV). It indicates current hepatitis B infection. The viral envelope of an enveloped virus has different surface proteins from the rest of the virus which act as antigens. These antigens are recognized by antibody proteins that bind specifically to one of these surface proteins.