Anti-Alpha Defensin 1/DEFA1 Antibody Picoband™ | Boster A10546 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Alpha Defensin 1/DEFA1 Antibody Picoband™

catalog :

A10546

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot

product information

SKU :

A10546

Product Name :

Anti-Alpha Defensin 1/DEFA1 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Rat

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Rat.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Alpha Defensin 1/DEFA1 Antibody Picoband™ catalog # A10546. Tested in WB applications. This antibody reacts with Human, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

DEFA1

Uniprot ID :

P59665

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human Alpha Defensin 1 (65-94aa ACYCRIPACIAGERRYGTCIYQGRLWAFCC).

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Neutrophil defensin 1

Synonyms :

Neutrophil defensin 1; Defensin, alpha 1; HNP-1; HP-1; HP1; HP 1-56; Neutrophil defensin 2; HNP-2; HP-2; HP2; DEFA1; DEF1, DEFA2, MRS; DEFA1B;

Protein Name :

Neutrophil defensin 1

Molecular Weight :

10201 MW

Protein Function :

Defensin 1 and defensin 2 have antibacterial, fungicide and antiviral activities. Has antimicrobial activity against Gram- negative and Gram-positive bacteria. Defensins are thought to kill microbes by permeabilizing their plasma membrane.

Subcellular Localization :

Secreted.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

Defensin, alpha 1, also known as human alpha defensin 1, human neutrophil peptide 1 (HNP-1) or neutrophil defensin 1 is a human protein that is encoded by the DEFA1 gene. Defensins are a family of antimicrobial and cytotoxic peptides thought to be involved in host defense. They are abundant in the granules of neutrophils and also found in the epithelia of mucosal surfaces such as those of the intestine, respiratory tract, urinary tract, and vagina. Members of the defensin family are highly similar in protein sequence and distinguished by a conserved cysteine motif. The protein encoded by this gene, defensin, alpha 1, is found in the microbicidal granules of neutrophils and likely plays a role in phagocyte-mediated host defense. Several alpha defensin genes are clustered on chromosome 8. This gene differs from defensin, alpha 3 by only one amino acid. This gene and the gene encoding defensin, alpha 3 are both subject to copy number variation.

Research Category :

Defensin, Human Protein, Immunology, Innate Immunity, Macrophage / Inflamm., Microbiology, Protein, Secreted Molecules