Anti-AKAP2 Antibody Picoband™ | Boster A09279 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-AKAP2 Antibody Picoband™

catalog :

A09279

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot

product information

SKU :

A09279

Product Name :

Anti-AKAP2 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Rat

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Rat.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-AKAP2 Antibody Picoband™ catalog # A09279. Tested in WB applications. This antibody reacts with Human, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

AKAP2

Uniprot ID :

Q9Y2D5

Immunogen :

identical to the related mouse and rat sequences.
ETHKSKRRERMDDSSVLEATRVNRRKSALALRWEAGIYA
N),
A synthetic peptide corresponding to a sequence at the C-terminus of human AKAP2 (813-852aa

Form :

Lyophilized

Contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

A-kinase anchor protein 2

Synonyms :

A-kinase anchor protein 2; AKAP-2; AKAP-KL; Protein kinase A-anchoring protein 2; PRKA2; AKAP2; KIAA0920, PRKA2;

Protein Name :

A-kinase anchor protein 2

Molecular Weight :

94661 MW

Protein Function :

Binds to regulatory subunit (RII) of protein kinase A. May be involved in establishing polarity in signaling systems or in integrating PKA-RII isoforms with downstream effectors to capture, amplify and focus diffuse, trans-cellular signals carried by cAMP (By similarity).

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

A-kinase anchor protein 2 is an enzyme that in humans is encoded by the AKAP2 gene. It is mapped to 9q31.3. The protein encoded by this gene binds to the regulatory subunit of protein kinase A and is found associated with the actin cytoskeleton. The encoded protein mediates signals carried by cAMP and may be involved in creating polarity in certain signaling processes. Three transcript variants encoding different isoforms have been found for this gene.

Research Category :

Protein Phosphorylation, Ser / Thr Kinases, Signal Transduction