This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-FOXL1 Picoband Antibody
catalog :
A08745-1
quantity :
100 ug/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
sku :
A08745-1
status :
Enabled
name :
Anti-FOXL1 Picoband Antibody
category name :
Primary Antibodies, Polyclonal Antibodies
gene name :
FOXL1
price various sizes :
100ug / $240 100ug+Free HRP Secondary BA1054 / $240 100ug+Free Biotin Secondary BA1003 / $240
clonality :
Polyclonal
concentration :
0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.
conjugate :
No
contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .
description :
Rabbit IgG polyclonal antibody for FOXL1 detection. Tested with WB in Human;Mouse;Rat.
short description :
Rabbit IgG polyclonal antibody for FOXL1 detection. Tested with WB in Human;Mouse;Rat.
size :
100 ug/vial
uniprot id :
Q12952
host :
Rabbit
immunogen :
A synthetic peptide corresponding to a sequence of human FOXL1 (NASLMLDPHVQGGFYQLGIPFLSYFPLQVPDTVLHFQ).
form :
Lyophilized
storage :
At -20 C for one year. After reconstitution, at 4 C for one month. It can also be aliquotted and stored frozen at -20 C for a longer time. Avoid repeated freezing and thawing.
cross reactivity :
No cross reactivity with other proteins.
reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
application details :
Western blot,0.1-0.5ug/ml.
applications :
WB
reactivity :
Human, Mouse, Rat
image labels :
Figure 1. Western blot analysis of FOXL1 using anti-FOXL1 antibody (A08745-1). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat stomach tissue lysates,. Lane 2: mouse stomach tissue lysates. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-FOXL1 antigen affinity purified polyclonal antibody (Catalog # A08745-1) at 0.5 ug/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for FOXL1 at approximately 36KD. The expected band size for FOXL1 is at 36KD.
background :
This gene encodes a member of the forkhead/winged helix-box (FOX) family of transcription factors. FOX transcription factors are characterized by a distinct DNA-binding forkhead domain and play critical roles in the regulation of multiple processes including metabolism, cell proliferation and gene expression during ontogenesis. This gene is mapped to chromosome 16q24.1 based on an alignment of the FOXL1 sequence with the genomic sequence (build 36.1).
research category :
Domain Families, Epigenetics And Nuclear Signaling, Forkhead Box, Transcription, Transcription Factors
synonyms :
Forkhead box protein L1; Forkhead-related protein FKHL11; Forkhead-related transcription factor 7; FREAC-7; FOXL1; FKHL11; FREAC7
gene full name :
forkhead box L1
protein function :
Transcription factor required for proper proliferation and differentiation in the gastrointestinal epithelium. Target gene of the hedgehog (Hh) signaling pathway via GLI2 AND GLI3 transcription factors (By similarity).
recommended detection systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
last modified :
2/6/19 22:57
company information

Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments