Anti-Annexin VIII/ANXA8 Antibody Picoband™ | Boster A08645 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Annexin VIII/ANXA8 Antibody Picoband™

catalog :

A08645

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, flow cytometry

product information

SKU :

A08645

Product Name :

Anti-Annexin VIII/ANXA8 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human

Application(s) :

Flow Cytometry, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human. Flow Cytometry, 1-3µg/1x10^6 cells, Human

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-Annexin VIII/ANXA8 Antibody Picoband™ catalog # A08645. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

ANXA8

Uniprot ID :

P13928

Immunogen :

different from the related mouse and rat sequences by one amino acid.
HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQ
IAK),
A synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII (20-61aa

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Annexin A8

Synonyms :

Annexin A8 ; Annexin VIII ; Annexin-8 ; Vascular anticoagulant-beta ; VAC-beta ; ANXA8 ; ANX8;

Protein Name :

Annexin A8

Molecular Weight :

36881 MW

Protein Function :

This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

ANXA8 is also known as ANNEXIN VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.

Research Category :

Signal Transduction, Cardiovascular, Cytoskeleton, Cytoskeleton / Ecm, Actin Binding Proteins, Actin Etc, Microfilaments, Cell Adhesion