This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Annexin VIII/ANXA8 Antibody Picoband™
catalog :
A08645
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, flow cytometry
product information
SKU :
A08645
Product Name :
Anti-Annexin VIII/ANXA8 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human
Application(s) :
Flow Cytometry, WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human.
Flow Cytometry, 1-3µg/1x10^6 cells, Human
Application Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-Annexin VIII/ANXA8 Antibody Picoband™ catalog # A08645. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
ANXA8
Uniprot ID :
P13928
Immunogen :
different from the related mouse and rat sequences by one amino acid.
HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQ
IAK),
A synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII (20-61aa
HFNPDPDAETLYKAMKGIGTNEQAIIDVLTKRSNTQRQQ
IAK),
A synthetic peptide corresponding to a sequence at the N-terminus of human Annexin VIII (20-61aa
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Annexin A8
Synonyms :
Annexin A8 ; Annexin VIII ; Annexin-8 ; Vascular anticoagulant-beta ; VAC-beta ; ANXA8 ; ANX8;
Protein Name :
Annexin A8
Molecular Weight :
36881 MW
Protein Function :
This protein is an anticoagulant protein that acts as an indirect inhibitor of the thromboplastin-specific complex, which is involved in the blood coagulation cascade.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
ANXA8 is also known as ANNEXIN VIII. This gene encodes a member of the annexin family of evolutionarily conserved Ca2+ and phospholipid binding proteins. The encoded protein may function as an anticoagulant that indirectly inhibits the thromboplastin-specific complex. Overexpression of this gene has been associated with acute myelocytic leukemia. A highly similar duplicated copy of this gene is found in close proximity on the long arm of chromosome 10.
Research Category :
Signal Transduction, Cardiovascular, Cytoskeleton, Cytoskeleton / Ecm, Actin Binding Proteins, Actin Etc, Microfilaments, Cell Adhesion
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments
