This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Human BMP5 DyLight® 550 conjugated Antibody
catalog :
A05887-Dyl550
quantity :
50 ug/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
DyLight 550
reactivity :
human
application :
flow cytometry
product information
SKU :
A05887-Dyl550
Product Name :
Anti-Human BMP5 DyLight® 550 conjugated Antibody
Size :
50 ug/vial
Clonality :
Polyclonal
Host :
Rabbit
Conjugate :
DyLight®550
Reactivity :
Human
Application(s) :
Flow Cytometry
Application Details :
Flow Cytometry, 1-3μg/1x10^6 cells
Description :
Boster Bio Anti-Human BMP5 DyLight® 550 conjugated Antibody catalog # A05887-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.
Concentration :
0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.
Gene Name :
BMP5
Uniprot ID :
P22003
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.
Form :
Liquid
Contents :
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
At 2-8?C for one year from date of receipt. Protect from light. Do not freeze.
Gene Full Name :
bone morphogenetic protein 5
Synonyms :
Bone morphogenetic protein 5; BMP-5; BMP5
Protein Function :
Induces cartilage and bone formation.
Subcellular Localization :
Secreted.
Tissue Specificity :
Expressed in the lung and liver.
Background :
Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.
Research Category :
Angiogenesis, Cardiovascular, Collagen, Cytoskeleton / Ecm, Ecm Proteins, Extracellular Matrix, Growth Factors, Growth Factors/Hormones, Secreted, Signal Transduction, Signaling Pathways, Stem Cells, Structures, Tgf Beta
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments
