Anti-Human BMP5 DyLight® 488 conjugated Antibody | Boster A05887-Dyl488 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Human BMP5 DyLight® 488 conjugated Antibody

catalog :

A05887-Dyl488

quantity :

50 ug/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

DyLight488

reactivity :

human

application :

flow cytometry

product information

SKU :

A05887-Dyl488

Product Name :

Anti-Human BMP5 DyLight® 488 conjugated Antibody

Size :

50 ug/vial

Clonality :

Polyclonal

Host :

Rabbit

Conjugate :

DyLight®488

Reactivity :

Human

Application(s) :

Flow Cytometry

Application Details :

Flow Cytometry, 1-3μg/1x10^6 cells

Description :

Boster Bio Anti-Human BMP5 DyLight® 488 conjugated Antibody catalog # A05887-Dyl488. Tested in Flow Cytometry applications. This antibody reacts with Human.

Concentration :

0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.

Gene Name :

BMP5

Uniprot ID :

P22003

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human BMP5 (332-365aa HQDSSRMSSVGDYNTSEQKQACKKHELYVSFRDL), different from the related mouse sequence by three amino acids.

Form :

Liquid

Contents :

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

At 2-8?C for one year from date of receipt. Protect from light. Do not freeze.

Gene Full Name :

bone morphogenetic protein 5

Synonyms :

Bone morphogenetic protein 5; BMP-5; BMP5

Protein Function :

Induces cartilage and bone formation.

Subcellular Localization :

Secreted.

Tissue Specificity :

Expressed in the lung and liver.

Background :

Bone morphogenetic protein 5 is a protein that in humans is encoded by the BMP5 gene. This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. And this protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors.

Research Category :

Angiogenesis, Cardiovascular, Collagen, Cytoskeleton / Ecm, Ecm Proteins, Extracellular Matrix, Growth Factors, Growth Factors/Hormones, Secreted, Signal Transduction, Signaling Pathways, Stem Cells, Structures, Tgf Beta