Anti-Annexin VII/ANXA7 Picoband Antibody | Boster A04889 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Annexin VII/ANXA7 Picoband Antibody

catalog :

A04889

quantity :

100 ug/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot

product information

sku :

A04889

status :

Enabled

name :

Anti-Annexin VII/ANXA7 Picoband Antibody

category name :

Primary Antibodies, Polyclonal Antibodies

gene name :

ANXA7

price various sizes :

30ug sample size / $99 100ug / $240 100ug+Free HRP Secondary BA1054 / $240 100ug+Free Biotin Secondary BA1003 / $240

clonality :

Polyclonal

concentration :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

conjugate :

contents :

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

description :

Polyclonal antibody for ANNEXIN VII/ANXA7 detection. Host: Rabbit.Size: 100ug/vial. Tested applications: WB. Reactive species: Human. ANNEXIN VII/ANXA7 information: Molecular Weight: 52739 MW; Tissue Specificity: Isoform 1 is expressed in brain, heart and skeletal muscle. Isoform 2 is more abundant in liver, lung, kidney, spleen, fibroblasts and placenta.

short description :

Rabbit IgG polyclonal antibody for Annexin A7(ANXA7) detection. Tested with WB in Human.

size :

100 ug/vial

sample size available :

30ug for $99, contact us for details

uniprot id :

P20073

host :

Rabbit

immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human Annexin VII (434-466aa TDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTL), different from the related mouse sequence by one amino acid.

form :

Lyophilized

purification :

Immunogen affinity purified.

storage :

At -20 C for one year. After reconstitution, at 4 C for one month. It can also be aliquotted and stored frozen at -20 C for a longer time.Avoid repeated freezing and thawing.

cross reactivity :

No cross reactivity with other proteins.

reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

application details :

Western blot, 0.1-0.5ug/ml, Human.

applications :

reactivity :

Human

image labels :

Western blot analysis of Annexin VII expression in JURKAT whole cell lysates (lane 1). Annexin VII at 52KD was detected using rabbit anti- Annexin VII Antigen Affinity purified polyclonal antibody (Catalog # A04889) at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method (Catalog # EK1002).

background :

ANXA7 (Annexin A7), also known as ANX7 or SNX, is a protein that in humans is encoded by the ANXA7 gene. Annexin VII is a member of the annexin family of calcium-dependent phospholipid binding proteins. This gene is mapped to 10q21.1-q21.2 by study of somatic cell hybrids and by in situ hybridization. The ANX7 gene exhibits many biologic and genetic properties expected of a tumor suppressor gene and may play a role in prostate cancer progression. Based on studies of recombinant human ANXA7 and isolated bovine chromaffin cells, it is showed that ANXA7 is a Ca(2+)-dependent GTP binding protein. ANXA7 was active in a chromaffin granule aggregation assays in the presence of Ca(2+) and GTP, and was deactivated upon GTP hydrolysis.

research category :

Calcium Channels, Calcium Signaling, Cell Adhesion, Cytoskeleton / Ecm, Signal Transduction, Signaling Pathway

synonyms :

Annexin A7;Annexin VII;Annexin-7;Synexin;ANXA7;ANX7, SNX;OK/SW-cl.95;

gene full name :

Annexin A7

molecular weight :

52739 MW

protein function :

Calcium/phospholipid-binding protein which promotes membrane fusion and is involved in exocytosis.

tissue specificity :

Isoform 1 is expressed in brain, heart and skeletal muscle. Isoform 2 is more abundant in liver, lung, kidney, spleen, fibroblasts and placenta.

protein name :

Annexin A7

recommended detection systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

last modified :

1/28/19 19:39