This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Myoglobin/MB Antibody Picoband™
catalog :
A04058
quantity :
100 ug/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
SKU :
A04058
Product Name :
Anti-Myoglobin/MB Antibody Picoband™
Size :
100 ug/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human
Application(s) :
WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human.
Application Notes :
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-Myoglobin/MB Antibody Picoband™ catalog # A04058. Tested in WB applications. This antibody reacts with Human.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
MB
Uniprot ID :
P02144
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human Myoglobin (3-35aa LSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFK), different from the related mouse sequence by three amino acids, and from the related rat sequence by six amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Myoglobin
Synonyms :
Myoglobin; MB;
Molecular Weight :
17184 MW
Protein Function :
Serves as a reserve supply of oxygen and facilitates the movement of oxygen within muscles.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
Myoglobin (MB) also known as PVALB, is a single-chain globular protein of 153 or 154 amino acids, containing a heme (iron-containing porphyrin) prosthetic group in the center around which the remaining apoprotein folds. It is a member of the globin superfamily and is expressed in skeletal and cardiac muscles. This gene is mapped to chromosome 22q11-q13. Myoglobin is released from damaged muscle tissue (rhabdomyolysis), which has very high concentrations of myoglobin. The released myoglobin is filtered by the kidneys but is toxic to the renal tubular epithelium and so may cause acute renal failure.
Research Category :
Cancer, Cardiovascular, Energy Metabolism, Energy Transfer Pathways, Metabolic Signaling Pathways, Metabolism, Oxidative Stress, Pathways And Processes, Redox Metabolism, Signal Transduction
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits