antibody

Anti-Integrin alpha 1/ITGA1 Antibody Picoband‚Ñ¢

A03829

10 ug sample

99 USD

polyclonal

domestic rabbit

nonconjugated

human, mouse, rat

western blot, immunohistochemistry

1

Anti-Integrin alpha 1/ITGA1 Antibody Picoband‚Ñ¢

anti-integrin-alpha-1-picoband-trade-antibody-a03829-boster

Primary Antibodies

ITGA1

315

10 ug sample

99 USD

Full size

315

Full size carrier free

365

Polyclonal

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.

Boster Bio Anti-Integrin alpha 1/ITGA1 Antibody Picoband catalog # A03829. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

Boster Bio Anti-Integrin alpha 1/ITGA1 Antibody Picoband catalog # A03829. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.

100ug/vial

P56199

Rabbit

A synthetic peptide corresponding to a sequence of human Integrin alpha 1 (TEEVLVAAKKIVQRGGRQTMTALGIDTARKEAFTEAR).

Lyophilized

Store at -20ÀöC for one year from date of receipt. After reconstitution, at 4ÀöC for one month. It can also be aliquotted and stored frozen at -20ÀöC for six months. Avoid repeated freeze-thaw cycles.

No cross reactivity with other proteins.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Western blot, 0.1-0.5ug/ml. Immunohistochemistry (Paraffin-embedded Section), 0.5-1ug/ml.

IHC,WB

Human,Mouse,Rat

/A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-2.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-3.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-WB-testing-1.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-5.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-6.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-4.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-8.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-9.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-7.jpg

Figure 2. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of mouse liver tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 3. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of human cholangiocarcinoma tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 1. Western blot analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human placenta tissue lysates . Lane 2: rat lung tissue lysates . Lane 3: mouse spleen tissue lysates . Lane 4: mouse heart tissue lysates . Lane 5: mouse lung tissue lysates . Lane 6: mouse ovary tissue lysates. After Electrophoresis proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Integrin alpha 1 antigen affinity purified polyclonal antibody (Catalog # A03829) at 0.5 μg/mL overnight at 4°C then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Integrin alpha 1 at approximately 200KD. The expected band size for Integrin alpha 1 is at 131KD. Figure 5. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 6. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 4. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of mouse cardiac muscle tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 8. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 9. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of rat spleen tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 7. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.

name=Conjugation,required=0,price=0.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Unconjugated 100μg name=Conjugation,required=0,price=100.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Alexa Fluor 488 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Biotin 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=HRP 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Cy3 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Dylight 350 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Dylight 488 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Dylight 550 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Dylight 594 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=FITC 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=PE 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=PE-Allo 594 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=PE-Cy5 50μg name=Size,required=1,price=-216.0000,type=radio,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=10ug sample name=Size,required=1,price=0.0000,type=radio,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Full size name=Size,required=1,price=50.0000,type=radio,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Full size carrier free

4/25/18 10:29

3/2/22 2:56

Integrin alpha 1/ITGA1 Antibody

Anti-Integrin alpha 1/ITGA1 Antibody Picoband

Boster Bio Anti-Integrin alpha 1/ITGA1 Antibody Picoband catalog # A03829. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Supplied as 100ug/vial in Lyophilized form antibody.

100

Integrin alpha 1 (ITGA1) chain associates with the beta 1 (ITGB1) chain to form a heterodimer that functions as a dual laminin/collagen receptor in neural cells and hematopoietic cells. ITGA1 has a 206-amino acid I domain in its N-terminal half, followed by 3 divalent cation-binding sites and a C-terminal transmembrane domain with a short cytoplasmic tail. It also has 28 potential N-glycosylation sites. Human ITGA1 was expressed in a mouse fibroblast cell line as a 180-kD protein. ITGA1 is involved in the early remodeling of osteoarthritic cartilage and plays an essential role in the regulation of mesenchymal stem cell proliferation and cartilage production. It also plays an essential role in the regulation of MSC proliferation and cartilage production.

Cancer,Cell Adhesion,Cytoskeleton / Ecm,Integrins,Invasion/Microenvironment,Signal Transduction

Integrin alpha-1; CD49 antigen-like family member A; Laminin and collagen receptor; VLA-1; CD49a; ITGA1

integrin subunit alpha 1

Integrin alpha-1/beta-1 is a receptor for laminin and collagen. It recognizes the proline-hydroxylated sequence G-F-P-G- E-R in collagen. Involved in anchorage-dependent, negative regulation of EGF-stimulated cell growth.

Membrane; Single-pass type I membrane protein.

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

antibodies