This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Integrin alpha 1/ITGA1 Antibody Picoband‚Ñ¢
catalog :
A03829
quantity :
10 ug sample
price :
99 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry
product information
sku :
A03829
status :
1
name :
Anti-Integrin alpha 1/ITGA1 Antibody Picoband‚Ñ¢
url key :
anti-integrin-alpha-1-picoband-trade-antibody-a03829-boster
product category :
Primary Antibodies
gene name :
ITGA1
price :
315
size 1 :
10 ug sample
price for size 1 :
99 USD
size 2 :
Full size
price for size 2 :
315
size 3 :
Full size carrier free
price for size 3 :
365
clonality :
Polyclonal
concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl and 0.2mg Na2HPO4.
description :
Boster Bio Anti-Integrin alpha 1/ITGA1 Antibody Picoband catalog # A03829. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
short description :
Boster Bio Anti-Integrin alpha 1/ITGA1 Antibody Picoband catalog # A03829. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
size :
100ug/vial
uniprot id :
P56199
host :
Rabbit
immunogen :
A synthetic peptide corresponding to a sequence of human Integrin alpha 1 (TEEVLVAAKKIVQRGGRQTMTALGIDTARKEAFTEAR).
form :
Lyophilized
storage :
Store at -20ÀöC for one year from date of receipt. After reconstitution, at 4ÀöC for one month. It can also be aliquotted and stored frozen at -20ÀöC for six months. Avoid repeated freeze-thaw cycles.
cross reactivity :
No cross reactivity with other proteins.
reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
application details :
Western blot, 0.1-0.5ug/ml.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1ug/ml.
applications :
IHC,WB
reactivity :
Human,Mouse,Rat
images :
/A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-2.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-3.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-WB-testing-1.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-5.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-6.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-4.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-8.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-9.jpg /A/0/A03829-Integrin-alpha-1-primary-antibodies-IHC-testing-7.jpg
image labels :
Figure 2. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of mouse liver tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 3. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of human cholangiocarcinoma tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 1. Western blot analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human placenta tissue lysates . Lane 2: rat lung tissue lysates . Lane 3: mouse spleen tissue lysates . Lane 4: mouse heart tissue lysates . Lane 5: mouse lung tissue lysates . Lane 6: mouse ovary tissue lysates. After Electrophoresis proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Integrin alpha 1 antigen affinity purified polyclonal antibody (Catalog # A03829) at 0.5 μg/mL overnight at 4°C then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Integrin alpha 1 at approximately 200KD. The expected band size for Integrin alpha 1 is at 131KD. Figure 5. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of rat lung tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 6. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of human lung cancer tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 4. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of mouse cardiac muscle tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 8. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of human tonsil tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 9. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of rat spleen tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen. Figure 7. IHC analysis of Integrin alpha 1 using anti-Integrin alpha 1 antibody (A03829). Integrin alpha 1 was detected in paraffin-embedded section of human placenta tissue. Heat mediated antigen retrieval was performed in citrate buffer (pH6 epitope retrieval solution) for 20 mins. The tissue section was blocked with 10% goat serum. The tissue section was then incubated with 2μg/ml rabbit anti-Integrin alpha 1 Antibody (A03829) overnight at 4°C. Biotinylated goat anti-rabbit IgG was used as secondary antibody and incubated for 30 minutes at 37°C. The tissue section was developed using Strepavidin-Biotin-Complex (SABC)(Catalog # SA1022) with DAB as the chromogen.
custom options :
name=Conjugation,required=0,price=0.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Unconjugated 100μg name=Conjugation,required=0,price=100.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Alexa Fluor 488 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Biotin 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=HRP 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Cy3 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Dylight 350 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Dylight 488 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Dylight 550 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Dylight 594 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=FITC 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=PE 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=PE-Allo 594 50μg name=Conjugation,required=0,price=50.0000,type=drop_down,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=PE-Cy5 50μg name=Size,required=1,price=-216.0000,type=radio,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=10ug sample name=Size,required=1,price=0.0000,type=radio,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Full size name=Size,required=1,price=50.0000,type=radio,sku=,max_characters=0,file_extension=,image_size_x=0,image_size_y=0,price_type=fixed,option_title=Full size carrier free
created at :
4/25/18 10:29
updated at :
3/2/22 2:56
meta title :
Integrin alpha 1/ITGA1 Antibody
meta keyword :
Anti-Integrin alpha 1/ITGA1 Antibody Picoband
meta description :
Boster Bio Anti-Integrin alpha 1/ITGA1 Antibody Picoband catalog # A03829. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat. Supplied as 100ug/vial in Lyophilized form antibody.
rating value :
100
background :
Integrin alpha 1 (ITGA1) chain associates with the beta 1 (ITGB1) chain to form a heterodimer that functions as a dual laminin/collagen receptor in neural cells and hematopoietic cells. ITGA1 has a 206-amino acid I domain in its N-terminal half, followed by 3 divalent cation-binding sites and a C-terminal transmembrane domain with a short cytoplasmic tail. It also has 28 potential N-glycosylation sites. Human ITGA1 was expressed in a mouse fibroblast cell line as a 180-kD protein. ITGA1 is involved in the early remodeling of osteoarthritic cartilage and plays an essential role in the regulation of mesenchymal stem cell proliferation and cartilage production. It also plays an essential role in the regulation of MSC proliferation and cartilage production.
research category :
Cancer,Cell Adhesion,Cytoskeleton / Ecm,Integrins,Invasion/Microenvironment,Signal Transduction
synonyms :
Integrin alpha-1; CD49 antigen-like family member A; Laminin and collagen receptor; VLA-1; CD49a; ITGA1
gene full name :
integrin subunit alpha 1
protein function :
Integrin alpha-1/beta-1 is a receptor for laminin and collagen. It recognizes the proline-hydroxylated sequence G-F-P-G- E-R in collagen. Involved in anchorage-dependent, negative regulation of EGF-stimulated cell growth.
subcellular localization :
Membrane; Single-pass type I membrane protein.
recommended detection systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
template :
antibodies
company information

Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments
