antibody

Anti-Aquaporin 9/AQP9 Picoband Antibody

A03638-1

100 ug/vial

polyclonal

domestic rabbit

nonconjugated

human, mouse, rat

Enabled

Anti-Aquaporin 9/AQP9 Picoband Antibody

Primary Antibodies, Polyclonal Antibodies

AQP9

30ug sample size / $99 100ug / $240 100ug+Free HRP Secondary BA1054 / $240 100ug+Free Biotin Secondary BA1003 / $240

Polyclonal

0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.

No

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Polyclonal antibody for AQUAPORIN 9/AQP9 detection. Host: Rabbit.Size: 100ug/vial. Tested applications: WB. Reactive species: Human. AQUAPORIN 9/AQP9 information: Subcellular Localization: Membrane; Multi-pass membrane protein; Tissue Specificity: Highly expressed in peripheral leukocytes. Also expressed in liver, lung, and spleen.

Rabbit IgG polyclonal antibody for Aquaporin 9 detection. Tested with WB in Human;Mouse;Rat.

100 ug/vial

30ug for $99, contact us for details

O43315

Rabbit

A synthetic peptide corresponding to a sequence of human Aquaporin 9 (LVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM).

Lyophilized

At -20 C for one year. After reconstitution, at 4 C for one month. It can also be aliquotted and stored frozen at -20 C for a longer time. Avoid repeated freezing and thawing.

No cross reactivity with other proteins.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Western blot, 0.1-0.5ug/ml.

WB

Human, Mouse, Rat

Figure 1. Western blot analysis of Aquaporin 9 using anti-Aquaporin 9 antibody (A03638-1). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysate,. Lane 2: mouse liver tissue lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Aquaporin 9 antigen affinity purified polyclonal antibody (Catalog # A03638-1) at 0.5 ug/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Aquaporin 9 at approximately 31KD. The expected band size for Aquaporin 9 is at 31KD.

Aquaporin-9 is a protein that in humans is encoded by the AQP9 gene. AQP9 encodes a 295-amino-acid protein with the amino acid sequence identity with AQP3 (48%), AQP7 (45%), and other aquaporins (approximately 30%), suggesting that AQP3, AQP7, and AQP9 belong to a subfamily of the aquaporin family. AQP9 is the major glycerol channel in mouse erythrocytes and suggest that this transport pathway may contribute to the virulence of intraerythrocytic stages of malarial infection.

Cancer, Channels, Metabolism, Plasma Membrane, Signal Transduction

Aquaporin-9; AQP-9; Aquaglyceroporin-9; Small solute channel 1; AQP9; SSC1

aquaporin 9

Forms a channel with a broad specificity. Mediates passage of a wide variety of non-charged solutes including carbamides, polyols, purines, and pyrimidines in a phloretin- and mercury-sensitive manner, whereas amino acids, cyclic sugars, Na(+), K(+), Cl(-), and deprotonated monocarboxylates are excluded. Also permeable to urea and glycerol.

Membrane; Multi-pass membrane protein.

Highly expressed in peripheral leukocytes. Also expressed in liver, lung, and spleen.

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

2/6/19 22:57