This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Aquaporin 9/AQP9 Picoband Antibody
catalog :
A03638-1
quantity :
100 ug/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
sku :
A03638-1
status :
Enabled
name :
Anti-Aquaporin 9/AQP9 Picoband Antibody
category name :
Primary Antibodies, Polyclonal Antibodies
gene name :
AQP9
price various sizes :
30ug sample size / $99 100ug / $240 100ug+Free HRP Secondary BA1054 / $240 100ug+Free Biotin Secondary BA1003 / $240
clonality :
Polyclonal
concentration :
0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.
conjugate :
No
contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .
description :
Polyclonal antibody for AQUAPORIN 9/AQP9 detection. Host: Rabbit.Size: 100ug/vial. Tested applications: WB. Reactive species: Human. AQUAPORIN 9/AQP9 information: Subcellular Localization: Membrane; Multi-pass membrane protein; Tissue Specificity: Highly expressed in peripheral leukocytes. Also expressed in liver, lung, and spleen.
short description :
Rabbit IgG polyclonal antibody for Aquaporin 9 detection. Tested with WB in Human;Mouse;Rat.
size :
100 ug/vial
sample size available :
30ug for $99, contact us for details
uniprot id :
O43315
host :
Rabbit
immunogen :
A synthetic peptide corresponding to a sequence of human Aquaporin 9 (LVIEIHHPEPDSVFKTEQSEDKPEKYELSVIM).
form :
Lyophilized
storage :
At -20 C for one year. After reconstitution, at 4 C for one month. It can also be aliquotted and stored frozen at -20 C for a longer time. Avoid repeated freezing and thawing.
cross reactivity :
No cross reactivity with other proteins.
reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
application details :
Western blot, 0.1-0.5ug/ml.
applications :
WB
reactivity :
Human, Mouse, Rat
image labels :
Figure 1. Western blot analysis of Aquaporin 9 using anti-Aquaporin 9 antibody (A03638-1). Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: rat liver tissue lysate,. Lane 2: mouse liver tissue lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-Aquaporin 9 antigen affinity purified polyclonal antibody (Catalog # A03638-1) at 0.5 ug/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for Aquaporin 9 at approximately 31KD. The expected band size for Aquaporin 9 is at 31KD.
background :
Aquaporin-9 is a protein that in humans is encoded by the AQP9 gene. AQP9 encodes a 295-amino-acid protein with the amino acid sequence identity with AQP3 (48%), AQP7 (45%), and other aquaporins (approximately 30%), suggesting that AQP3, AQP7, and AQP9 belong to a subfamily of the aquaporin family. AQP9 is the major glycerol channel in mouse erythrocytes and suggest that this transport pathway may contribute to the virulence of intraerythrocytic stages of malarial infection.
research category :
Cancer, Channels, Metabolism, Plasma Membrane, Signal Transduction
synonyms :
Aquaporin-9; AQP-9; Aquaglyceroporin-9; Small solute channel 1; AQP9; SSC1
gene full name :
aquaporin 9
protein function :
Forms a channel with a broad specificity. Mediates passage of a wide variety of non-charged solutes including carbamides, polyols, purines, and pyrimidines in a phloretin- and mercury-sensitive manner, whereas amino acids, cyclic sugars, Na(+), K(+), Cl(-), and deprotonated monocarboxylates are excluded. Also permeable to urea and glycerol.
subcellular localization :
Membrane; Multi-pass membrane protein.
tissue specificity :
Highly expressed in peripheral leukocytes. Also expressed in liver, lung, and spleen.
recommended detection systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
last modified :
2/6/19 22:57
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits