Anti-SLC31A1/CTR1 Antibody Picoband™ | Boster A03447-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-SLC31A1/CTR1 Antibody Picoband™

catalog :

A03447-1

quantity :

100µg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

product information

SKU :

A03447-1

Product Name :

Anti-SLC31A1/CTR1 Antibody Picoband™

Size :

100µg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml.

Description :

Boster Bio Anti-SLC31A1/CTR1 Antibody Picoband™ catalog # A03447-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

SLC31A1

Uniprot ID :

O15431

Immunogen :

A synthetic peptide corresponding to a sequence of human SLC31A1/CTR1 (NGTILMETHKTVGQQMLSFPHLLQTVLHIIQ).

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

solute carrier family 31 member 1

Synonyms :

High affinity copper uptake protein 1; Copper transporter 1; hCTR1; Solute carrier family 31 member 1; SLC31A1; COPT1; CTR1

Protein Function :

High-affinity, saturable copper transporter involved in dietary copper uptake.

Subcellular Localization :

Cell membrane; Localizes to the apical membrane in intestinal epithelial cells.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

High affinity copper uptake protein 1 (Ctr1) is a protein that in humans is encoded by the SLC31A1 gene. This gene is maped to 9q32. The protein encoded by this gene is a high-affinity copper transporter found in the cell membrane. The encoded protein functions as a homotrimer to effect the uptake of dietary copper.

Research Category :

Neuroscience, Neurotransmission, Receptors / Channels