Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband™

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband™

catalog :

A03294

quantity :

100µg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, flow cytometry, immunohistochemistry - paraffin section

product information

SKU :

A03294

Product Name :

Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband™

Size :

100µg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Flow Cytometry, IHC-P, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Mouse, Rat. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat. Flow Cytometry, 1-3µg/1x10^6 cells, Human.

Description :

Boster Bio Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody Picoband™ catalog # A03294. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

MOG

Uniprot ID :

Q16653

Immunogen :

A synthetic peptide corresponding to a sequence of human Myelin oligodendrocyte glycoprotein/MOG (RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK).

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

myelin oligodendrocyte glycoprotein

Synonyms :

Myelin-oligodendrocyte glycoprotein; MOG

Protein Function :

Mediates homophilic cell-cell adhesion (By similarity). Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication. Acts as a receptor for rubella virus.

Subcellular Localization :

Cell membrane. Multi-pass membrane protein. Single-pass type I membrane protein.

Tissue Specificity :

Found exclusively in the CNS, where it is localized on the surface of myelin and oligodendrocyte cytoplasmic membranes.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Background :

Myelin oligodendrocyte glycoprotein (MOG) is a glycoprotein believed to be important in the myelination of nerves in the central nervous system (CNS). In humans this protein is encoded by the MOG gene. This gene is mapped to 6p22.1. It is speculated to serve as a necessary "adhesion molecule" to provide structural integrity to the myelin sheath and is known to develop late on the oligodendrocyte. The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.

Research Category :

Cancer, Lipid Metabolism, Metabolism, Signal Transduction