Anti-Thrombospondin 2/THBS2 Antibody Picoband™ | Boster A03253-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Thrombospondin 2/THBS2 Antibody Picoband™

catalog :

A03253-1

quantity :

100µg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

product information

SKU :

A03253-1

Product Name :

Anti-Thrombospondin 2/THBS2 Antibody Picoband™

Size :

100µg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Mouse, Rat

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml.

Description :

Boster Bio Anti-Thrombospondin 2/THBS2 Antibody Picoband™ catalog # A03253-1. Tested in WB applications. This antibody reacts with Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

Thbs2

Uniprot ID :

Q03350

Immunogen :

A synthetic peptide corresponding to a sequence of mouse Thrombospondin 2 (DHVKDTSFDLFSISNINRKTIGAKQFRGPD).

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

thrombospondin 2

Synonyms :

Thrombospondin-2; THBS2; TSP2

Protein Function :

Adhesive glycoprotein that mediates cell-to-cell and cell-to-matrix interactions. Ligand for CD36 mediating antiangiogenic properties.

Tissue Specificity :

High expression in invertebral disk tissue.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

Thrombospondin-2 (THBS2) is a protein that in humans is encoded by the THBS2 gene. The protein encoded by this gene belongs to the thrombospondin family. The THBS2 is mapped to 6q27 and it is located on chromosome 17. The gene was transcribed in fibroblasts, smooth muscle cells, and an osteosarcoma cell line. It functions as a protein inhibitor of tumor growth and angiogenesis and modulates the cell surface properties of mesenchymal cells and be involved in cell adhesion and migration.