This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-CD105/ENG Antibody Picoband™
catalog :
A02997-1
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot
product information
SKU :
A02997-1
Product Name :
Anti-CD105/ENG Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.
Application Notes :
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-CD105/ENG Antibody Picoband™ catalog # A02997-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
ENG
Uniprot ID :
P17813
Immunogen :
different from the related mouse sequence by twelve amino acids.
YVSWLIDANHNMQIWTTGEYSFKIFPEKNIRGFKLPDTP
Q),
A synthetic peptide corresponding to a sequence in the middle region of human CD105 (258-297aa
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Endoglin
Synonyms :
Endoglin; CD105; ENG; END;
Protein Name :
Endoglin
Molecular Weight :
70578 MW
Protein Function :
Major glycoprotein of vascular endothelium. Involved in the regulation of angiogenesis. May play a critical role in the binding of endothelial cells to integrins and/or other RGD receptors. Acts as TGF-beta coreceptor and is involved in the TGF- beta/BMP signaling cascade. Required for GDF2/BMP9 signaling through SMAD1 in endothelial cells and modulates TGF-beta1 signaling through SMAD3.
Subcellular Localization :
Membrane; Single-pass type I membrane protein.
Tissue Specificity :
Endoglin is restricted to endothelial cells in all tissues except bone marrow.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
Endoglin (Osler-Rendu-Weber syndrome 1), CD105, is a type I membrane glycoprotein located on cell surfaces and is a part of the TGF beta receptor complex. Its gene is mapped to human chromosome 8. The protein consists of a homodimer of 180 kDA with disulfide links. It has been found on endothelial cells, activated macrophages, fibroblasts and smooth muscle cells. Endoglin has a role in the development of the cardiovascular system and in vascular remodeling and has been found to be elevated in pregnant women who subsequently develop preeclampsia.
Research Category :
Epigenetics and Nuclear Signaling, Neurogenesis, Neurology Process, Neuroscience, Transcription
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits