Anti-LGALS3BP Antibody Picoband™ | Boster A02938-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-LGALS3BP Antibody Picoband™

catalog :

A02938-1

quantity :

100µg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse

application :

western blot, immunohistochemistry

product information

SKU :

A02938-1

Product Name :

Anti-LGALS3BP Antibody Picoband™

Size :

100µg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse

Application(s) :

IHC, WB

Application Details :

Western blot,0.1-0.5µg/ml. Immunohistochemistry (Paraffin-embedded Section),0.5-1µg/ml.

Description :

Boster Bio Anti-LGALS3BP Antibody Picoband™ catalog # A02938-1. Tested in IHC, WB applications. This antibody reacts with Human, Mouse.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

LGALS3BP

Uniprot ID :

Q08380

Immunogen :

A synthetic peptide corresponding to a sequence of human LGALS3BP (HEALFQKKTLQALEFHTVPFQLLARYKGLNLTEDTYKPR).

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

galectin 3 binding protein

Synonyms :

Galectin-3-binding protein; Basement membrane autoantigen p105; Lectin galactoside-binding soluble 3-binding protein; Mac-2-binding protein; MAC2BP; Mac-2 BP; Tumor-associated antigen 90K; LGALS3BP; M2BP

Protein Function :

Promotes integrin-mediated cell adhesion. May stimulate host defense against viruses and tumor cells.

Subcellular Localization :

Secreted.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Background :

Galectin-3-binding protein is a protein that in humans is encoded by the LGALS3BP gene. The galectins are a family of beta-galactoside-binding proteins implicated in modulating cell-cell and cell-matrix interactions. LGALS3BP has been found elevated in the serum of patients with cancer and in those infected by the human immunodeficiency virus (HIV). It appears to be implicated in immune response associated with natural killer (NK) and lymphokine-activated killer (LAK) cell cytotoxicity. Using fluorescence in situ hybridization the full length 90K cDNA has been localized to chromosome 17q25. The native protein binds specifically to a human macrophage-associated lectin known as Mac-2 and also binds galectin 1.

Research Category :

Cancer, Cell Cycle, Cell Division, Oncoproteins, Tumor Biomarkers