This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-EBP1/PA2G4 Antibody Picoband™
catalog :
A02791
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry
product information
SKU :
A02791
Product Name :
Anti-EBP1/PA2G4 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
IHC, WB
Application Details :
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Mouse, Rat, Human, By Heat.
Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.
Application Notes :
Tested Species: In-house tested species with positive results.
Predicted Species: Species predicted to be fit for the product based on sequence similarities.
By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-EBP1/PA2G4 Antibody Picoband™ catalog # A02791. Tested in IHC, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
PA2G4
Uniprot ID :
Q9UQ80
Immunogen :
identical to the related mouse and rat sequences.
RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHS
FN),
A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa
RKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHS
FN),
A synthetic peptide corresponding to a sequence at the C-terminus of human EBP1 (138-178aa
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Proliferation-associated protein 2G4
Synonyms :
Proliferation-associated protein 2G4; Cell cycle protein p38-2G4 homolog; hG4-1; ErbB3-binding protein 1; PA2G4; EBP1;
Protein Name :
Proliferation-associated protein 2G4
Molecular Weight :
43787 MW
Protein Function :
May play a role in a ERBB3-regulated signal transduction pathway. Seems be involved in growth regulation. Acts a corepressor of the androgen receptor (AR) and is regulated by the ERBB3 ligand neuregulin-1/heregulin (HRG). Inhibits transcription of some E2F1-regulated promoters, probably by recruiting histone acetylase (HAT) activity. Binds RNA. Associates with 28S, 18S and 5.8S mature rRNAs, several rRNA precursors and probably U3 small nucleolar RNA. May be involved in regulation of intermediate and late steps of rRNA processing. May be involved in ribosome assembly. Mediates cap-independent translation of specific viral IRESs (internal ribosomal entry site) (By similarity). Regulates cell proliferation, differentiation, and survival. Isoform 1 suppresses apoptosis whereas isoform 2 promotes cell differentiation (By similarity).
Subcellular Localization :
Isoform 1: Cytoplasm. Nucleus, nucleolus. Tranlocates to the nucleus upon treatment with HRG. Phosphorylation at Ser-361 by PKC/PRKCD regulates its nucleolar localization.
Tissue Specificity :
Isoform 2 is undetectable whereas isoform 1 is strongly expressed in cancer cells (at protein level). Isoform 1 and isoform 2 are widely expressed, including heart, brain, lung, pancreas, skeletal muscle, kidney, placenta and liver.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Background :
Proliferation-associated protein 2G4 (PA2G4), also known as ErbB3-binding protein 1 (EBP1), is a protein that in humans is encoded by the PA2G4 gene. This gene encodes an RNA-binding protein that is involved in growth regulation. This protein is present in pre-ribosomal ribonucleoprotein complexes and may be involved in ribosome assembly and the regulation of intermediate and late steps of rRNA processing. This protein can interact with the cytoplasmic domain of the ErbB3 receptor and may contribute to transducing growth regulatory signals. This protein is also a transcriptional corepressor of androgen receptor-regulated genes and other cell cycle regulatory genes through its interactions with histone deacetylases.
Research Category :
Co-Activators/Co-Repressors, DNA / RNA, Epigenetics and Nuclear Signaling, Nuclear Receptors, Nuclear Signaling Pathways, Ribosome, RNA Processing, Transcription, Translation
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments
