Anti-Human ACTN3 DyLight® 550 conjugated Antibody | Boster A02693-Dyl550 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Human ACTN3 DyLight® 550 conjugated Antibody

catalog :

A02693-Dyl550

quantity :

50 ug/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

DyLight 550

reactivity :

human

application :

flow cytometry

product information

SKU :

A02693-Dyl550

Product Name :

Anti-Human ACTN3 DyLight® 550 conjugated Antibody

Size :

50 ug/vial

Clonality :

Polyclonal

Host :

Rabbit

Conjugate :

DyLight®550

Reactivity :

Human

Application(s) :

Flow Cytometry

Application Details :

Flow Cytometry, 1-3μg/1x10^6 cells

Description :

Boster Bio Anti-Human ACTN3 DyLight® 550 conjugated Antibody catalog # A02693-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.

Concentration :

0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.

Gene Name :

ACTN3

Uniprot ID :

Q08043

Immunogen :

K), different from the related mouse sequence by five amino acids.
EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQ
DINT
A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa

Form :

Liquid

Contents :

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

At 2-8?C for one year from date of receipt. Protect from light. Do not freeze.

Gene Full Name :

actinin alpha 3 (gene/pseudogene)

Synonyms :

Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3

Protein Function :

F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.

Tissue Specificity :

Expressed only in a subset of type 2 skeletal muscle fibers.

Background :

Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.

Research Category :

Actin Binding Proteins, Actin Etc, Cytoskeleton, Cytoskeleton / Ecm, Microfilaments, Signal Transduction