This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Human ACTN3 DyLight® 550 conjugated Antibody
catalog :
A02693-Dyl550
quantity :
50 ug/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
DyLight 550
reactivity :
human
application :
flow cytometry
product information
SKU :
A02693-Dyl550
Product Name :
Anti-Human ACTN3 DyLight® 550 conjugated Antibody
Size :
50 ug/vial
Clonality :
Polyclonal
Host :
Rabbit
Conjugate :
DyLight®550
Reactivity :
Human
Application(s) :
Flow Cytometry
Application Details :
Flow Cytometry, 1-3μg/1x10^6 cells
Description :
Boster Bio Anti-Human ACTN3 DyLight® 550 conjugated Antibody catalog # A02693-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.
Concentration :
0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.
Gene Name :
ACTN3
Uniprot ID :
Q08043
Immunogen :
K), different from the related mouse sequence by five amino acids.
EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQ
DINT
A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa
EADRERGAIMGIQGEIQKICQTYGLRPCSTNPYITLSPQ
DINT
A synthetic peptide corresponding to a sequence at the C-terminus of human ACTN3 (574-617aa
Form :
Liquid
Contents :
Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
At 2-8?C for one year from date of receipt. Protect from light. Do not freeze.
Gene Full Name :
actinin alpha 3 (gene/pseudogene)
Synonyms :
Alpha-actinin-3; Alpha-actinin skeletal muscle isoform 3; F-actin cross-linking protein; ACTN3
Protein Function :
F-actin cross-linking protein which is thought to anchor actin to a variety of intracellular structures. This is a bundling protein.
Tissue Specificity :
Expressed only in a subset of type 2 skeletal muscle fibers.
Background :
Alpha-actinin-3, also known as alpha-actinin skeletal muscle isoform 3 or F-actin cross-linking protein, is a protein that in humans is encoded by the ACTN3 gene. This gene encodes a member of the alpha-actin binding protein gene family. The encoded protein is primarily expressed in skeletal muscle and functions as a structural component of sarcomeric Z line. This protein is involved in crosslinking actin containing thin filaments. An allelic polymorphism in this gene results in both coding and non-coding variants; the reference genome represents the coding allele. The non-functional allele of this gene is associated with elite athlete status.
Research Category :
Actin Binding Proteins, Actin Etc, Cytoskeleton, Cytoskeleton / Ecm, Microfilaments, Signal Transduction
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments
