Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™ | Boster A02275-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™

catalog :

A02275-1

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

product information

SKU :

A02275-1

Product Name :

Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Mouse, Rat

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml, Mouse, Rat.

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-12 Lipoxygenase/ALOX12 Antibody Picoband™ catalog # A02275-1. Tested in WB applications. This antibody reacts with Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

ALOX12

Uniprot ID :

P18054

Immunogen :

different from the related mouse sequence by six amino acids, and from the related rat sequence by seven
ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQD
DELFSYQ),
A synthetic peptide corresponding to a sequence at the N-terminus of human 12 Lipoxygenase (186-231aa

Form :

Lyophilized

Contents :

Each vial contains 4 mg Trehalose, 0.9 mg NaCl and 0.2 mg Na2HPO4.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Arachidonate 12-lipoxygenase, 12S-type

Synonyms :

Arachidonate 12-lipoxygenase, 12S-type; 12S-LOX; 12S-lipoxygenase; 1.13.11.31; Lipoxin synthase 12-LO; 3.3.2.-; Platelet-type lipoxygenase 12; ALOX12; 12LO, LOG12;

Protein Name :

Arachidonate 12-lipoxygenase, 12S-type

Molecular Weight :

75694 MW

Protein Function :

Non-heme iron-containing dioxygenase that catalyzes the stereo-specific peroxidation of free and esterified polyunsaturated fatty acids generating a spectrum of bioactive lipid mediators. Mainly converts arachidonic acid to (12S)- hydroperoxyeicosatetraenoic acid/ (12S)-HPETE but can also metabolize linoleic acid. Has a dual activity since it also converts leukotriene A4/LTA4 into both the bioactive lipoxin A4/LXA4 and lipoxin B4/LXB4. Through the production of specific bioactive lipids like (12S)-HPETE it regulates different biological processes including platelet activation. It also probably positively regulates angiogenesis through regulation of the expression of the vascular endothelial growth factor. Plays a role in apoptotic process, promoting the survival of vascular smooth muscle cells for instance. May also play a role in the control of cell migration and proliferation.

Subcellular Localization :

Cytoplasm, cytosol. Membrane. Membrane association is stimulated by EGF.

Tissue Specificity :

Expressed in vascular smooth muscle cells.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

ALOX12, Arachidonate 12-lipoxygenase, is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the ALOX12 gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12 (S)-hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.

Research Category :

Cardiovascular, Cell Biology, Cell Cycle, Cell Differentiation, Lipases, Lipid And Lipoprotein Metabolism, Lipid Metabolism, Lipids / Lipoproteins, Metabolic Signaling Pathways, Metabolism, Pathways And Processes, Signal Transduction