Anti-Human POR DyLight® 550 conjugated Antibody | Boster A02166-Dyl550 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Human POR DyLight® 550 conjugated Antibody

catalog :

A02166-Dyl550

quantity :

50 ug/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

DyLight 550

reactivity :

human

application :

flow cytometry

product information

SKU :

A02166-Dyl550

Product Name :

Anti-Human POR DyLight® 550 conjugated Antibody

Size :

50 ug/vial

Clonality :

Polyclonal

Host :

Rabbit

Conjugate :

DyLight®550

Reactivity :

Human

Application(s) :

Flow Cytometry

Application Details :

Flow Cytometry, 1-3μg/1x10^6 cells

Description :

Boster Bio Anti-Human POR DyLight® 550 conjugated Antibody catalog # A02166-Dyl550. Tested in Flow Cytometry applications. This antibody reacts with Human.

Concentration :

0.5-1mg/ml, actual concentration vary by lot. Use suggested dilution ratio to decide dilution procedure.

Gene Name :

POR

Uniprot ID :

P16435

Immunogen :

A synthetic peptide corresponding to a sequence at the C-terminus of human POR (633-668aa RNMARDVQNTFYDIVAELGAMEHAQAVDYIKKLMTK), different from the related mouse and rat sequences by five amino acids.

Form :

Liquid

Contents :

Each vial contains 50% glycerol, 0.9% NaCl, 0.2% Na2HPO4, 0.02% NaN3.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

At 2-8?C for one year from date of receipt. Protect from light. Do not freeze.

Gene Full Name :

P450 (cytochrome) oxidoreductase

Synonyms :

NADPH--cytochrome P450 reductase

Protein Function :

This enzyme is required for electron transfer from NADP to cytochrome P450 in microsomes. It can also provide electron transfer to heme oxygenase and cytochrome B5.

Subcellular Localization :

Endoplasmic reticulum membrane

Background :

POR is a membrane-boundenzyme required for electron transfer from NADPH to cytochrome P450 in the endoplasmic reticulum of theeukaryotic cell. The gene encodes an endoplasmic reticulum membrane oxidoreductase with an FAD-binding domain and a flavodoxin-like domain. The protein binds two cofactors, FAD and FMN, which allow it to donate electrons directly from NADPH to all microsomal P450 enzymes. Mutations in this gene have been associated with various diseases, including apparent combined P450C17 and P450C21 deficiency, amenorrhea and disordered steroidogenesis, congenital adrenal hyperplasia and Antley-Bixler syndrome.

Research Category :

Cancer, Metabolism, Mitochondria, Mitochondrial, Mitochondrial Markers, Mitochondrial Metabolism, Organelles, Pathways And Processes, Signal Transduction, Subcellular Markers