This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-DR4/TNFRSF10A Antibody Picoband™
catalog :
A02152
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, immunohistochemistry, immunocytochemistry, flow cytometry
product information
SKU :
A02152
Product Name :
Anti-DR4/TNFRSF10A Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
Flow Cytometry, IHC, ICC, WB
Application Details :
Immunohistochemistry (Frozen Section), 0.5-1µg/ml.
Immunocytochemistry, 0.5-1µg/ml Western blot, 0.1-0.5µg/ml.Flow Cytometry, 1-3μg/1x10^6cells.
Application Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-DR4/TNFRSF10A Antibody Picoband™ catalog # A02152. Tested in Flow Cytometry, IHC, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
TNFRSF10A
Uniprot ID :
O00220
Immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human DR4 (99-131aa VLLQVVPSSAATIKLHDQSIGTQQWEHSPLGEL).
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Tumor necrosis factor receptor superfamily member 10A
Synonyms :
Tumor necrosis factor receptor superfamily member 10A; Death receptor 4; TNF-related apoptosis-inducing ligand receptor 1; TRAIL receptor 1; TRAIL-R1; CD261; TNFRSF10A; APO2, DR4, TRAILR1;
Protein Name :
Tumor necrosis factor receptor superfamily member 10A
Molecular Weight :
50089 MW
Protein Function :
Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF- kappa-B.
Subcellular Localization :
Membrane; Single-pass type I membrane protein.
Tissue Specificity :
Widely expressed. High levels are found in spleen, peripheral blood leukocytes, small intestine and thymus, but also in K-562 erythroleukemia cells, MCF-7 breast carcinoma cells and activated T-cells.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(F) and ICC.
Background :
TNFRSF10A (Tumor Necrosis Factor Receptor Subfamily Member 10A), also known as APO2, DR4 or TRAILR1, is a protein that in humans is encoded by the TNFRSF10A gene. The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor is activated by tumor necrosis factor-related apoptosis inducing ligand (TNFSF10/TRAIL), and thus transduces cell death signal and induces cell apoptosis. Studies with FADD-deficient mice suggested that FADD, a death domain containing adaptor protein, is required for the apoptosis mediated by this protein.
Research Category :
Apoptosis, Cell Biology, Cytokines, Immunology, Innate Immunity, Receptors, Tnf Superfamily
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments