Anti-Fatty Acid Binding Protein 5/FABP5 Antibody Picoband™

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Fatty Acid Binding Protein 5/FABP5 Antibody Picoband™

catalog :

A02083

quantity :

100µg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunocytochemistry, immunohistochemistry - paraffin section

product information

SKU :

A02083

Product Name :

Anti-Fatty Acid Binding Protein 5/FABP5 Antibody Picoband™

Size :

100µg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

IF, IHC-P, ICC, WB

Application Details :

Western blot,0.1-0.5µg/ml. Immunohistochemistry (Paraffin-embedded Section),0.5-1µg/ml. Immunocytochemistry/Immunofluorescence, 5 µg/ml.

Description :

Boster Bio Anti-Fatty Acid Binding Protein 5/FABP5 Antibody Picoband™ catalog # A02083. Tested in IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

FABP5

Uniprot ID :

Q01469

Immunogen :

A synthetic peptide corresponding to a sequence of human FABP5 (KWRLMESHGFEEYMKELGVGLALRKMAAMAKPD).

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

fatty acid binding protein 5 (psoriasis-associated)

Synonyms :

Fatty acid-binding protein, epidermal; Epidermal-type fatty acid-binding protein; E-FABP; Fatty acid-binding protein 5; Psoriasis-associated fatty acid-binding protein homolog; PA-FABP; FABP5

Protein Function :

High specificity for fatty acids. Highest affinity for C18 chain length. Decreasing the chain length or introducing double bonds reduces the affinity. May be involved in keratinocyte differentiation.

Subcellular Localization :

Cytoplasm

Tissue Specificity :

Keratinocytes; highly expressed in psoriatic skin.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and ICC.

Background :

FABP5, Fatty acid-binding protein, epidermal, is a protein that in humans is encoded by the FABP5 gene. This gene encodes the fatty acid binding protein found in epidermal cells, and was first identified as being upregulated in psoriasis tissue. It is mapped to 8q21.13. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind long-chain fatty acids and other hydrophobic ligands. It is thought that FABPs roles include fatty acid uptake, transport, and metabolism.

Research Category :

Cancer, Cardiovascular, Fatty Acid Oxidation, Fatty Acids, Lipid And Lipoprotein Metabolism, Lipid Metabolism, Lipids / Lipoproteins, Metabolic Signaling Pathways, Metabolism, Pathways And Processes, Redox Metabolism, Signal Transduction