This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Nicotinic Acetylcholine Receptor alpha 3/CHRNA3 Antibody Picoband™
catalog :
A01981-1
quantity :
100µg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, flow cytometry
product information
SKU :
A01981-1
Product Name :
Anti-Nicotinic Acetylcholine Receptor alpha 3/CHRNA3 Antibody Picoband™
Size :
100µg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse, Rat
Application(s) :
Flow Cytometry, WB
Application Details :
Western blot,0.1-0.5µg/ml.
Flow Cytometry, 1-3μg/1x10^6 cells, Human
Description :
Boster Bio Anti-Nicotinic Acetylcholine Receptor alpha 3/CHRNA3 Antibody Picoband™ catalog # A01981-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
CHRNA3
Uniprot ID :
P32297
Immunogen :
A synthetic peptide corresponding to a sequence of human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD).
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
cholinergic receptor nicotinic alpha 3 subunit
Synonyms :
Neuronal acetylcholine receptor subunit alpha-3; CHRNA3; NACHRA3
Protein Function :
After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.
Subcellular Localization :
Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments
