Anti-Nicotinic Acetylcholine Receptor alpha 3/CHRNA3 Antibody Picoband™

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Nicotinic Acetylcholine Receptor alpha 3/CHRNA3 Antibody Picoband™

catalog :

A01981-1

quantity :

100µg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, flow cytometry

product information

SKU :

A01981-1

Product Name :

Anti-Nicotinic Acetylcholine Receptor alpha 3/CHRNA3 Antibody Picoband™

Size :

100µg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Flow Cytometry, WB

Application Details :

Western blot,0.1-0.5µg/ml. Flow Cytometry, 1-3μg/1x10^6 cells, Human

Description :

Boster Bio Anti-Nicotinic Acetylcholine Receptor alpha 3/CHRNA3 Antibody Picoband™ catalog # A01981-1. Tested in Flow Cytometry, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

CHRNA3

Uniprot ID :

P32297

Immunogen :

A synthetic peptide corresponding to a sequence of human CHRNA3 (DAVLSLSALSPEIKEAIQSVKYIAENMKAQNEAKEIQD).

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

cholinergic receptor nicotinic alpha 3 subunit

Synonyms :

Neuronal acetylcholine receptor subunit alpha-3; CHRNA3; NACHRA3

Protein Function :

After binding acetylcholine, the AChR responds by an extensive change in conformation that affects all subunits and leads to opening of an ion-conducting channel across the plasma membrane.

Subcellular Localization :

Cell junction, synapse, postsynaptic cell membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot