antibody

Anti-KPNA2 Antibody Picoband™

A01776-1

100 ug/vial

polyclonal

domestic rabbit

nonconjugated

Anti-KPNA2 Antibody Picoband™

100 ug/vial

Polyclonal

Rabbit

Human

WB

Western blot, 0.1-0.5µg/ml, Human.

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Boster Bio Anti-KPNA2 Antibody Picoband™ catalog # A01776-1. Tested in WB applications. This antibody reacts with Human.

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

KPNA2

P52292

different from the related mouse sequence by three amino acids.
STNENANTPAARLHRFKNKGKDSTEMRRRRIEVNVELRK
AKKDDQ),
A synthetic peptide corresponding to a sequence at the N-terminus of human KPNA2 (2-46aa

Lyophilized

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

No cross reactivity with other proteins.

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Importin subunit alpha-1

Importin subunit alpha-1; Karyopherin subunit alpha-2; RAG cohort protein 1; SRP1-alpha; KPNA2; RCH1, SRP1;

57862 MW

Functions in nuclear protein import as an adapter protein for nuclear receptor KPNB1. Binds specifically and directly to substrates containing either a simple or bipartite NLS motif. Docking of the importin/substrate complex to the nuclear pore complex (NPC) is mediated by KPNB1 through binding to nucleoporin FxFG repeats and the complex is subsequently translocated through the pore by an energy requiring, Ran- dependent mechanism. At the nucleoplasmic side of the NPC, Ran binds to importin-beta and the three components separate and importin-alpha and -beta are re-exported from the nucleus to the cytoplasm where GTP hydrolysis releases Ran from importin. The directionality of nuclear import is thought to be conferred by an asymmetric distribution of the GTP- and GDP-bound forms of Ran between the cytoplasm and nucleus.

Cytoplasm. Nucleus.

Expressed ubiquitously.

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Importin subunit alpha-2 is a protein that in humans is encoded by the KPNA2 gene. The import of proteins into the nucleus is a process that involves at least 2 steps. The first is an energy-independent docking of the protein to the nuclear envelope and the second is an energy-dependent translocation through the nuclear pore complex. Imported proteins require a nuclear localization sequence (NLS) which generally consists of a short region of basic amino acids or 2 such regions spaced about 10 amino acids apart. Proteins involved in the first step of nuclear import have been identified in different systems. These include the Xenopus protein importin and its yeast homolog, SRP1 (a suppressor of certain temperature-sensitive mutations of RNA polymerase I in Saccharomyces cerevisiae), which bind to the NLS. KPNA2 protein interacts with the NLSs of DNA helicase Q1 and SV40 T antigen and may be involved in the nuclear transport of proteins. KPNA2 also may play a role in V (D)J recombination.

Immunoglobulins, Immunology, Nuclear Import / Export, Protein Trafficking, Signal Transduction