antibody

Anti-PROM1 Antibody Picoband™

A01767

100 ug/vial

polyclonal

domestic rabbit

nonconjugated

human, mouse, rat

Anti-PROM1 Antibody Picoband™

100 ug/vial

Polyclonal

Rabbit

Human, Mouse, Rat

WB

Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat.

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Boster Bio Anti-PROM1 Antibody Picoband™ catalog # A01767. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

PROM1

O43490

A synthetic peptide corresponding to a sequence at the C-terminus of human PROM1 (808-841aa ALIFAVKLAKYYRRMDSEDVYDDVETIPMKNMEN), different from the related mouse sequence by six amino acids.

Lyophilized

Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Immunogen affinity purified.

No cross reactivity with other proteins.

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Prominin-1

Prominin-1; Antigen AC133; Prominin-like protein 1; CD133; PROM1; PROML1; MSTP061;

97202 MW

May play a role in cell differentiation, proliferation and apoptosis (PubMed:24556617). Binds cholesterol in cholesterol- containing plasma membrane microdomains and may play a role in the organization of the apical plasma membrane in epithelial cells. During early retinal development acts as a key regulator of disk morphogenesis. Involved in regulation of MAPK and Akt signaling pathways. In neuroblastoma cells suppresses cell differentiation such as neurite outgrowth in a RET-dependent manner (PubMed:20818439).

Apical cell membrane ; Multi- pass membrane protein. Cell projection, microvillus membrane ; Multi-pass membrane protein. Cell projection, cilium, photoreceptor outer segment. Endoplasmic reticulum. Endoplasmic reticulum-Golgi intermediate compartment. Found in extracellular membrane particles in various body fluids such as cerebrospinal fluid, saliva, seminal fluid and urine.

Isoform 1 is selectively expressed on CD34 hematopoietic stem and progenitor cells in adult and fetal bone marrow, fetal liver, cord blood and adult peripheral blood. Isoform 1 is not detected on other blood cells. Isoform 1 is also expressed in a number of non-lymphoid tissues including retina, pancreas, placenta, kidney, liver, lung, brain and heart. Found in saliva within small membrane particles. Isoform 2 is predominantly expressed in fetal liver, skeletal muscle, kidney, and heart as well as adult pancreas, kidney, liver, lung, and placenta. Isoform 2 is highly expressed in fetal liver, low in bone marrow, and barely detectable in peripheral blood. Isoform 2 is expressed on hematopoietic stem cells and in epidermal basal cells (at protein level). Expressed in adult retina by rod and cone photoreceptor cells (at protein level).

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Prominin-1, also known as CD133, is a glycoprotein that in humans is encoded by the PROM1 gene. It is mapped to 4p15.32. Prominin-1 is a member of pentaspan transmembrane glycoproteins (5-transmembrane, 5-TM), which specifically localize to cellular protrusions. This gene encodes a pentaspan transmembrane glycoprotein. The protein localizes to membrane protrusions and is often expressed on adult stem cells, where it is thought to function in maintaining stem cell properties by suppressing differentiation. It has been proposed to act as an organizer of cell membrane topology. Prominin-1 was expressed not only on metastatic colon cancer cells, but also on differentiated colonic epithelium in both adult mice and humans.

Cell Type Marker, Hematopoietic Progenitors, Neural Stem Cells, Neuroscience, Stem Cells, Surface Molecules