This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-IFNGR1 Antibody Picoband™
catalog :
A01716-2
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, flow cytometry
product information
SKU :
A01716-2
Product Name :
Anti-IFNGR1 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human
Application(s) :
Flow Cytometry, WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human.
Flow Cytometry, 1-3μg/1x10^6 cells, Human
Application Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-IFNGR1 Antibody Picoband™ catalog # A01716-2. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
IFNGR1
Uniprot ID :
P15260
Immunogen :
different from the related mouse sequence by eighteen amino acids.
QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIF
H),
A synthetic peptide corresponding to a sequence at the N-terminus of human IFNGR1 (108-147aa
QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIF
H),
A synthetic peptide corresponding to a sequence at the N-terminus of human IFNGR1 (108-147aa
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Interferon gamma receptor 1
Synonyms :
Interferon gamma receptor 1; IFN-gamma receptor 1; IFN-gamma-R1; CDw119; CD119; IFNGR1;
Protein Name :
Interferon gamma receptor 1
Molecular Weight :
54405 MW
Protein Function :
Associates with IFNGR2 to form a receptor for the cytokine interferon gamma (IFNG) (PubMed:7615558, PubMed:2971451, PubMed:7617032, PubMed:10986460). Ligand binding stimulates activation of the JAK/STAT signaling pathway (PubMed:7673114).
Subcellular Localization :
Cell membrane ; Single-pass type I membrane protein.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.
Research Category :
Antiviral Signaling, Cytokines, Hematopoietic Progenitors, Host Virus Interaction, Immune System Diseases, Immunology, Innate Immunity, Interferons, Interspecies Interaction, Lymphoid, Macrophage / Inflamm., Microbiology, Myeloid, Stem Cells, Surface Molecules, T Lymphocytic Lineage
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments