Anti-IFNGR1 Antibody Picoband™ | Boster A01716-2 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-IFNGR1 Antibody Picoband™

catalog :

A01716-2

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, flow cytometry

product information

SKU :

A01716-2

Product Name :

Anti-IFNGR1 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human

Application(s) :

Flow Cytometry, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human. Flow Cytometry, 1-3μg/1x10^6 cells, Human

Application Notes :

Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-IFNGR1 Antibody Picoband™ catalog # A01716-2. Tested in Flow Cytometry, WB applications. This antibody reacts with Human.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

IFNGR1

Uniprot ID :

P15260

Immunogen :

different from the related mouse sequence by eighteen amino acids.
QKESAYAKSEEFAVCRDGKIGPPKLDIRKEEKQIMIDIF
H),
A synthetic peptide corresponding to a sequence at the N-terminus of human IFNGR1 (108-147aa

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Interferon gamma receptor 1

Synonyms :

Interferon gamma receptor 1; IFN-gamma receptor 1; IFN-gamma-R1; CDw119; CD119; IFNGR1;

Protein Name :

Interferon gamma receptor 1

Molecular Weight :

54405 MW

Protein Function :

Associates with IFNGR2 to form a receptor for the cytokine interferon gamma (IFNG) (PubMed:7615558, PubMed:2971451, PubMed:7617032, PubMed:10986460). Ligand binding stimulates activation of the JAK/STAT signaling pathway (PubMed:7673114).

Subcellular Localization :

Cell membrane ; Single-pass type I membrane protein.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

Interferon gamma receptor 1 (IFNGR1), also known as CD119 (Cluster of Differentiation 119), is a protein that in humans is encoded by the IFNGR1 gene. This gene (IFNGR1) encodes the ligand-binding chain (alpha) of the gamma interferon receptor. Human interferon-gamma receptor is a heterodimer of IFNGR1 and IFNGR2. A genetic variation in IFNGR1 is associated with susceptibility to Helicobacter pylori infection. In addition, defects in IFNGR1 are a cause of mendelian susceptibility to mycobacterial disease, also known as familial disseminated atypical mycobacterial infection.

Research Category :

Antiviral Signaling, Cytokines, Hematopoietic Progenitors, Host Virus Interaction, Immune System Diseases, Immunology, Innate Immunity, Interferons, Interspecies Interaction, Lymphoid, Macrophage / Inflamm., Microbiology, Myeloid, Stem Cells, Surface Molecules, T Lymphocytic Lineage