This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-PBP/PEBP1 Antibody Picoband™
catalog :
A01668
quantity :
100µg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human, mouse, rat
application :
western blot, flow cytometry, immunohistochemistry - paraffin section
product information
SKU :
A01668
Product Name :
Anti-PBP/PEBP1 Antibody Picoband™
Size :
100µg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Mouse
Application(s) :
Flow Cytometry, IHC-P, WB
Application Details :
Western blot, 0.1-0.5µg/ml.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1μg/ml.
Flow Cytometry, 1-3μg/1x10^6 cells
Description :
Boster Bio Anti-PBP/PEBP1 Antibody Picoband™ catalog # A01668. Tested in Flow Cytometry, IHC-P, WB applications. This antibody reacts with Human, Mouse.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
PEBP1
Uniprot ID :
P30086
Immunogen :
(DHRGKFKVASFRKKYELRAPVAGTCYQAEWDDYVPKLY
EQ).
A synthetic peptide corresponding to a sequence of human PBP
EQ).
A synthetic peptide corresponding to a sequence of human PBP
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
phosphatidylethanolamine binding protein 1
Synonyms :
Phosphatidylethanolamine-binding protein 1; PEBP-1; HCNPpp; Neuropolypeptide h3; Prostatic-binding protein; Raf kinase inhibitor protein; RKIP; Hippocampal cholinergic neurostimulating peptide; HCNP; PEBP1; PBP; PEBP
Protein Function :
Binds ATP, opioids and phosphatidylethanolamine. Has lower affinity for phosphatidylinositol and phosphatidylcholine. Serine protease inhibitor which inhibits thrombin, neuropsin and chymotrypsin but not trypsin, tissue type plasminogen activator and elastase (By similarity). Inhibits the kinase activity of RAF1 by inhibiting its activation and by dissociating the RAF1/MEK complex and acting as a competitive inhibitor of MEK phosphorylation.
Subcellular Localization :
Cytoplasm
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Background :
PEBP1 (Phosphatidylethanolamine-binding protein 1), also called PBP, RKIP, inhibits the phosphorylation and activation of MEK by RAF1. PEBP1 is identical to the phosphatidylethanolamine-binding protein (PBP) with a relative molecular mass of 23 kD. The PEBP1 gene is mapped on 12q24.23. PEBP1 coimmunoprecipitates with RAF1 and MEK from cell lysates and colocalizes with RAF1 when examined by confocal microscopy. PEBP1 overexpression interferes with the activation of MEK and ERK, induction of AP1-dependent reporter genes, and transformation elicited by an oncogenically activated RAF1 kinase. PEBP1 expression was rapidly upregulated during induction of chemotherapy-triggered apoptosis in human prostate and breast cancer cell lines, and maximal RKIP expression correlated perfectly with the onset of apoptosis by Chatterjee et al (2004). RKIP depletion decreased the mitotic index, the number of metaphase cells, traversal times from nuclear envelope breakdown to anaphase, and an override of mitotic checkpoints induced by spindle poisons.
Research Category :
Epigenetics and Nuclear Signaling, Cancer, Cell Biology, Oncoproteins/Suppressors, Tumor Suppressors, Cell Cycle, Neuroscience, Cell Division, Kinases/Phosphatases, Spindle, Neurotransmitter, Neuropeptides
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments
