Anti-RHOB Antibody Picoband™ | Boster A01550-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-RHOB Antibody Picoband™

catalog :

A01550-1

quantity :

100µg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human

application :

western blot, immunohistochemistry - paraffin section

product information

SKU :

A01550-1

Product Name :

Anti-RHOB Antibody Picoband™

Size :

100µg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Monkey, Mouse, Rat

Application(s) :

IHC-P, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Monkey, Mouse, Rat. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human.

Description :

Boster Bio Anti-RHOB Antibody Picoband™ catalog # A01550-1. Tested in IHC-P, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

RHOB

Uniprot ID :

P62745

Immunogen :

(NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAY
DYLE).
A synthetic peptide corresponding to a sequence of human RHOB

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Gene Full Name :

ras homolog family member B

Synonyms :

Rho-related GTP-binding protein RhoB; Rho cDNA clone 6; h6; RHOB; ARH6; ARHB

Protein Function :

Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.

Subcellular Localization :

Cell membrane, Lipid-anchor, Late endosome membrane, Nucleus, Cleavage furrow.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).

Background :

Ras homolog gene family, member B, also known as RHOB, is a protein which in humans is encoded by the RHOB gene. This gene is mapped to 2p24.1. It is a member of the Rho GTP-binding protein family. And RHOB has been shown to interact with CIT, ARHGEF3, ARHGDIG and RHPN2. RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. Also, it serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis.

Research Category :

Small G Proteins, Vesicle Transport