This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-RHOB Antibody Picoband™
catalog :
A01550-1
quantity :
100µg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, immunohistochemistry - paraffin section
product information
SKU :
A01550-1
Product Name :
Anti-RHOB Antibody Picoband™
Size :
100µg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human, Monkey, Mouse, Rat
Application(s) :
IHC-P, WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human, Monkey, Mouse, Rat.
Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human.
Description :
Boster Bio Anti-RHOB Antibody Picoband™ catalog # A01550-1. Tested in IHC-P, WB applications. This antibody reacts with Human, Monkey, Mouse, Rat.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
RHOB
Uniprot ID :
P62745
Immunogen :
(NKKDLRSDEHVRTELARMKQEPVRTDDGRAMAVRIQAY
DYLE).
A synthetic peptide corresponding to a sequence of human RHOB
DYLE).
A synthetic peptide corresponding to a sequence of human RHOB
Form :
Lyophilized
Contents :
Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Gene Full Name :
ras homolog family member B
Synonyms :
Rho-related GTP-binding protein RhoB; Rho cDNA clone 6; h6; RHOB; ARH6; ARHB
Protein Function :
Mediates apoptosis in neoplastically transformed cells after DNA damage. Not essential for development but affects cell adhesion and growth factor signaling in transformed cells. Plays a negative role in tumorigenesis as deletion causes tumor formation. Involved in intracellular protein trafficking of a number of proteins. Targets PKN1 to endosomes and is involved in trafficking of the EGF receptor from late endosomes to lysosomes. Also required for stability and nuclear trafficking of AKT1/AKT which promotes endothelial cell survival during vascular development. Serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis. Required for genotoxic stress-induced cell death in breast cancer cells.
Subcellular Localization :
Cell membrane, Lipid-anchor, Late endosome membrane, Nucleus, Cleavage furrow.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P).
Background :
Ras homolog gene family, member B, also known as RHOB, is a protein which in humans is encoded by the RHOB gene. This gene is mapped to 2p24.1. It is a member of the Rho GTP-binding protein family. And RHOB has been shown to interact with CIT, ARHGEF3, ARHGDIG and RHPN2. RHOB plays a negative role in tumorigenesis as deletion causes tumor formation. Also, it serves as a microtubule-dependent signal that is required for the myosin contractile ring formation during cell cycle cytokinesis.
Research Category :
Small G Proteins, Vesicle Transport
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments