Anti-HnRNP A1/HNRNPA1 Antibody Picoband™ | Boster A01476 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-HnRNP A1/HNRNPA1 Antibody Picoband™

catalog :

A01476

quantity :

100μg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, rat

application :

western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section

product information

SKU :

A01476

Product Name :

Anti-HnRNP A1/HNRNPA1 Antibody Picoband™

Size :

100μg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Flow Cytometry, IF, IHC-P, ICC, WB

Application Details :

Western blot, 0.1-0.5µg/ml, Human, Mouse, Rat. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml, Human, Mouse, Rat, By Heat. Immunofluorescence, 2µg/ml, Human. Immunocytochemistry/Immunofluorescence, 2µg/ml, Human. Flow Cytometry, 1-3μg/1x10^6 cells, Human

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-HnRNP A1/HNRNPA1 Antibody Picoband™ catalog # A01476. Tested in Flow Cytometry, IF, IHC-P, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

HNRNPA1

Uniprot ID :

P09651

Immunogen :

A synthetic peptide corresponding to a sequence at the N-terminus of human HnRNP A1 (8-42aa KEPEQLRKLFIGGLSFETTDESLRSHFEQWGTLTD), identical to the related mouse and rat sequences.

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.

Purification :

Immunogen affinity purified.

Cross-reactivity :

No cross reactivity with other proteins

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

Heterogeneous nuclear ribonucleoprotein A1

Synonyms :

Heterogeneous nuclear ribonucleoprotein A1; hnRNP A1; Helix-destabilizing protein; Single-strand RNA-binding protein; hnRNP core protein A1; Heterogeneous nuclear ribonucleoprotein A1, N-terminally processed; HNRNPA1; HNRPA1;

Protein Name :

Heterogeneous nuclear ribonucleoprotein A1

Molecular Weight :

38747 MW

Protein Function :

Involved in the packaging of pre-mRNA into hnRNP particles, transport of poly (A) mRNA from the nucleus to the cytoplasm and may modulate splice site selection. May play a role in HCV RNA replication.

Subcellular Localization :

Nucleus. Cytoplasm. Localized in cytoplasmic mRNP granules containing untranslated mRNAs. Shuttles continuously between the nucleus and the cytoplasm along with mRNA. Component of ribonucleosomes. In the course of viral infection, colocalizes with HCV NS5B at speckles in the cytoplasm in a HCV-replication dependent manner.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P) and ICC.

Background :

Heterogeneous nuclear ribonucleoprotein A1 is a protein that in humans is encoded by the HNRNPA1 gene. This gene encodes a member of a family of ubiquitously expressed heterogeneous nuclear ribonucleoproteins (hnRNPs), which are RNA-binding proteins that associate with pre-mRNAs in the nucleus and influence pre-mRNA processing, as well as other aspects of mRNA metabolism and transport. The protein encoded by this gene is one of the most abundant core proteins of hnRNP complexes and plays a key role in the regulation of alternative splicing. Mutations in this gene have been observed in individuals with amyotrophic lateral sclerosis 20. Multiple alternatively spliced transcript variants have been found. There are numerous pseudogenes of this gene distributed throughout the genome.