product summary
Loading...
company name :
Boster
product type :
antibody
product name :
Anti-IL6R Antibody Picoband™
catalog :
A01425-1
quantity :
100 ug/vial
price :
315 USD
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
more info or order :
citations: 1
Reference
Pang X, Yang J, Zhen X, Nie H, Qin H, Huang L, et al. The Role of IL-6RA in UHMWPE Promotes Proliferation in Fibro-Like Synovial Cells. Biomed Res Int. 2018;2018:3928915 pubmed publisher
image
image 1 :
Boster A01425-1 image 1
Figure 1. Western blot analysis of IL6R using anti-IL6R antibody (A01425-1). . Electrophoresis was performed on a 5-20% SDS-PAGE gel at 70V (Stacking gel) / 90V (Resolving gel) for 2-3 hours. The sample well of each lane was loaded with 50ug of sample under reducing conditions. Lane 1: human A549 whole cell lysate. After Electrophoresis, proteins were transferred to a Nitrocellulose membrane at 150mA for 50-90 minutes. Blocked the membrane with 5% Non-fat Milk/ TBS for 1.5 hour at RT. The membrane was incubated with rabbit anti-IL6R antigen affinity purified polyclonal antibody (Catalog # A01425-1) at 0.5 ug/mL overnight at 4°C, then washed with TBS-0.1%Tween 3 times with 5 minutes each and probed with a goat anti-rabbit IgG-HRP secondary antibody at a dilution of 1:10000 for 1.5 hour at RT. The signal is developed using an Enhanced Chemiluminescent detection (ECL) kit (Catalog # EK1002) with Tanon 5200 system. A specific band was detected for IL6R at approximately 52KD. The expected band size for IL6R is at 52KD.
product information
SKU :
A01425-1
Product Name :
Anti-IL6R Antibody Picoband™
Price :
315 USD
Size :
100 ug/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human
Application(s) :
WB
Application Details :
Western blot, 0.1-0.5µg/ml, Human.
Application Notes :
Tested Species: In-house tested species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-IL6R Antibody Picoband™ catalog # A01425-1. Tested in WB applications. This antibody reacts with Human.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
IL6R
Uniprot ID :
P08887
Immunogen :
LLCIAIVLRFKKTWKLRALKEGKTSMHPPYSLGQLVPER
PR).
A synthetic peptide corresponding to a sequence at the C-terminus of human IL6R (379-419aa
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Interleukin-6 receptor subunit alpha
Synonyms :
Interleukin-6 receptor subunit alpha; IL-6 receptor subunit alpha; IL-6R subunit alpha; IL-6R-alpha; IL-6RA; IL-6R 1; Membrane glycoprotein 80; gp80; CD126; IL6R;
Molecular Weight :
51548 MW
Protein Function :
Part of the receptor for interleukin 6. Binds to IL6 with low affinity, but does not transduce a signal. Signal activation necessitate an association with IL6ST. Activation may lead to the regulation of the immune response, acute-phase reactions and hematopoiesis.
Subcellular Localization :
Isoform 1: Basolateral cell membrane; Single-pass type I membrane protein.
Tissue Specificity :
Isoform 2 is expressed in peripheral blood mononuclear cells and weakly found in urine and serum.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
Interleukin 6 receptor (IL6R), also known as CD126 (Cluster of Differentiation 126), is a type I cytokine receptor. This gene encodes a subunit of the interleukin 6 (IL6) receptor complex. Interleukin 6 is a potent pleiotropic cytokine that regulates cell growth and differentiation and plays an important role in the immune response. The IL6 receptor is a protein complex consisting of this protein and interleukin 6 signal transducer (IL6ST/GP130/IL6-beta), a receptor subunit also shared by many other cytokines. Dysregulated production of IL6 and this receptor are implicated in the pathogenesis of many diseases, such as multiple myeloma, autoimmune diseases and prostate cancer. Alternatively spliced transcript variants encoding distinct isoforms have been reported. A pseudogene of this gene is found on chromosome 9.
Research Category :
Cytokines, Hematopoietic Progenitors, Immunology, Innate Immunity, Interleukins, Lymphoid, Myeloid, Stem Cells, T Lymphocytic Lineage
more info or order :
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com
925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits