Anti-Melanoma gp100/PMEL Antibody Picoband™ | Boster A01262-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-Melanoma gp100/PMEL Antibody Picoband™

catalog :

A01262-1

quantity :

100µg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot

product information

SKU :

A01262-1

Product Name :

Anti-Melanoma gp100/PMEL Antibody Picoband™

Size :

100µg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Application Details :

Western blot, 0.1-0.5µg/ml.

Description :

Boster Bio Anti-Melanoma gp100/PMEL Antibody Picoband™ catalog # A01262-1. Tested in WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

PMEL

Uniprot ID :

P40967

Immunogen :

A synthetic peptide corresponding to a sequence of human Melanoma gp100/PMEL (KVPRNQDWLGVSRQLRTKAWNRQLYPEWTEAQRLD).

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

premelanosome protein

Synonyms :

Melanocyte protein PMEL; ME20-M; ME20M; Melanocyte protein Pmel 17; Melanocytes lineage-specific antigen GP100; Melanoma-associated ME20 antigen; P1; P100; Premelanosome protein; Silver locus protein homolog; M-alpha; 95 kDa melanocyte-specific secreted glycoprotein; P26; Secreted melanoma-associated ME20 antigen; ME20-S; ME20S; M-beta; PMEL; D12S53E; PMEL17; SILV

Protein Function :

Plays a central role in the biogenesis of melanosomes. Involved in the maturation of melanosomes from stage I to II. The transition from stage I melanosomes to stage II melanosomes involves an elongation of the vesicle, and the appearance within of distinct fibrillar structures. Release of the soluble form, ME20-S, could protect tumor cells from antibody mediated immunity.

Subcellular Localization :

multivesicular body. Endoplasmic reticulum membrane. Single-pass type I membrane protein. Golgi apparatus. Melanosome. Secreted.

Tissue Specificity :

Preferentially expressed in melanomas. Some expression was found in dysplastic nevi. Not found in normal tissues nor in carcinomas. Normally expressed at low levels in quiescent adult melanocytes but overexpressed by proliferating neonatal melanocytes and during tumor growth.

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.

Background :

This gene is mapped to 12q13.2. It encodes a melanocyte-specific type I transmembrane glycoprotein. The encoded protein is enriched in melanosomes, which are the melanin-producing organelles in melanocytes, and plays an essential role in the structural organization of premelanosomes. This protein is involved in generating internal matrix fibers that define the transition from Stage I to Stage II melanosomes. This protein undergoes a complex pattern of prosttranslational processing and modification that is essential to the proper functioning of the protein. A secreted form of this protein that is released by proteolytic ectodomain shedding may be used as a melanoma-specific serum marker. Alternate splicing results in multiple transcript variants.

Research Category :

Amino Acid Metabolism, Amino Acids, Cancer, Cell Type Markers, Metabolic Signaling Pathways, Metabolism, Pathways And Processes, Signal Transduction, Tumor Associated, Tumor Immunology, Tumor-Associated Antigens