This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Choline Acetyltransferase/CHAT Picoband Antibody
catalog :
A01192-2
quantity :
100 ug/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot
product information
sku :
A01192-2
status :
Enabled
name :
Anti-Choline Acetyltransferase/CHAT Picoband Antibody
category name :
Primary Antibodies, Polyclonal Antibodies
gene name :
CHAT
price various sizes :
30ug sample size / $99 100ug / $240 100ug+Free HRP Secondary BA1054 / $240 100ug+Free Biotin Secondary BA1003 / $240
clonality :
Polyclonal
concentration :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
conjugate :
No
contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
description :
Polyclonal antibody for Choline Acetyltransferase/CHAT detection. Host: Rabbit.Size: 100ug/vial. Tested applications: WB. Reactive species: Human. Choline Acetyltransferase/CHAT information: Molecular Weight: 82536 MW; .
short description :
Rabbit IgG polyclonal antibody for Choline O-acetyltransferase(CHAT) detection. Tested with WB in Human.
size :
100 ug/vial
sample size available :
30ug for $99, contact us for details
uniprot id :
P28329
host :
Rabbit
immunogen :
A synthetic peptide corresponding to a sequence at the N-terminus of human CHAT (177-213aa ETLQQKLLERQEKTANWVSEYWLNDMYLNNRLALPVN), different from the related mouse and rat sequences by one amino acid.
form :
Lyophilized
purification :
Immunogen affinity purified.
storage :
At -20 C for one year. After reconstitution, at 4 C for one month. It can also be aliquotted and stored frozen at -20 C for a longer time.Avoid repeated freezing and thawing.
cross reactivity :
No cross reactivity with other proteins.
reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
application details :
Western blot, 0.1-0.5ug/ml, Human.
applications :
WB
reactivity :
Human
image labels :
Western blot analysis of CHAT expression in HELA whole cell lysates (lane 1). CHAT at 83KD was detected using rabbit anti- CHAT Antigen Affinity purified polyclonal antibody (Catalog # A01192-2) at 0.5 ug/mL. The blot was developed using chemiluminescence (ECL) method (Catalog # EK1002).
background :
Choline acetyltransferase (commonly abbreviated as ChAT, but sometimes CAT) is a transferase enzyme responsible for the synthesis of the neurotransmitter acetylcholine. In humans, the choline acetyltransferase enzyme is encoded by the CHAT gene. This gene product is a characteristic feature of cholinergic neurons, and changes in these neurons may explain some of the symptoms of Alzheimer's disease. Polymorphisms in this gene have been associated with Alzheimer's disease and mild cognitive impairment. Mutations in this gene are associated with congenital myasthenic syndrome associated with episodic apnea. Multiple transcript variants encoding different isoforms have been found for this gene, and some of these variants have been shown to encode more than one isoform.
competitor equivalent skus :
sc 20672 sc 19056 sc 55557 sc 19057
research category :
Cell Type Marker, Neuron Marker, Neuroscience, Neurotransmitter
synonyms :
Choline O-acetyltransferase;CHOACTase;ChAT;Choline acetylase;2.3.1.6;CHAT;
gene full name :
Choline O-acetyltransferase
molecular weight :
82536 MW
protein function :
Catalyzes the reversible synthesis of acetylcholine (ACh) from acetyl CoA and choline at cholinergic synapses.
protein name :
Choline O-acetyltransferase
recommended detection systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
last modified :
1/28/19 19:39
company information

Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments