This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.
product summary
company name :
Boster
product type :
antibody
product name :
Anti-Angiopoietin-like 4?/ANGPTL4 Antibody Picoband™
catalog :
A01147
quantity :
100μg/vial
clonality :
polyclonal
host :
domestic rabbit
conjugate :
nonconjugated
reactivity :
human
application :
western blot, ELISA
product information
SKU :
A01147
Product Name :
Anti-Angiopoietin-like 4?/ANGPTL4 Antibody Picoband™
Size :
100μg/vial
Clonality :
Polyclonal
Host :
Rabbit
Reactivity :
Human
Application(s) :
ELISA, WB
Application Details :
ELISA, 0.1-0.5µg/ml, Human Western blot, 0.1-0.5µg/ml, Human.
Application Notes :
Tested Species: In-house tested species with positive results.
Other applications have not been tested.
Optimal dilutions should be determined by end users.
Description :
Boster Bio Anti-Angiopoietin-like 4?/ANGPTL4 Antibody Picoband™ catalog # A01147. Tested in ELISA, WB applications. This antibody reacts with Human.
Concentration :
Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.
Gene Name :
ANGPTL4
Uniprot ID :
Q9BY76
Immunogen :
A synthetic peptide corresponding to a sequence at the C-terminus of human ANGPTL4 (369-406aa QQRQKLKKGIFWKTWRGRYYPLQATTMLIQPMAAEAAS), different from the related mouse and rat sequences by seven amino acids.
Form :
Lyophilized
Contents :
Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.
Purification :
Immunogen affinity purified.
Cross-reactivity :
No cross reactivity with other proteins.
Storage :
Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.
Reconstitution :
Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
Gene Full Name :
Angiopoietin-related protein 4
Synonyms :
Angiopoietin-related protein 4; Angiopoietin-like protein 4; Hepatic fibrinogen/angiopoietin-related protein; HFARP; ANGPTL4; ARP4, HFARP, PGAR; PP1158, PSEC0166, UNQ171/PRO197;
Protein Name :
Angiopoietin-related protein 4
Molecular Weight :
45214 MW
Protein Function :
Protein with hypoxia-induced expression in endothelial cells. May act as a regulator of angiogenesis and modulate tumorigenesis. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. May exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation (By similarity).
Subcellular Localization :
Secreted. Secreted, extracellular space, extracellular matrix. The unprocessed form interacts with the extracellular matrix. This may constitute a dynamic reservoir, a regulatory mechanism of the bioavailability of ANGPTL4 (By similarity).
Tissue Specificity :
Expressed at high levels in the placenta, heart, liver, muscle, pancreas and lung but expressed poorly in the brain and kidney.
Recommended Detection Systems :
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot.
Background :
Angiopoietin-related protein 4 (Angptl4) is a protein that in humans is encoded by the ANGPTL4 gene. This gene is a member of the angiopoietin/angiopoietin-like gene family and encodes a glycosylated, secreted protein with a fibrinogen C-terminal domain. And this gene is induced under hypoxic conditions in endothelial cells and is the target of peroxisome proliferation activators. By radiation hybrid analysis, Angptl4 gene is mapped to 19p13.3. ANGPTL4 contributed to tumor growth and protected cells from anoikis, a form of programmed cell death induced when contact-dependent cells detach from the surrounding tissue matrix.
Research Category :
Angiogenesis, Cancer, Cancer Metabolism, Cardiovascular, Cholesterol Metabolism, Growth Factors, Hypoxia, Lipid And Lipoprotein Metabolism, Lipid Metabolism, Lipids / Lipoproteins, Metabolic Signaling Pathway, Metabolic Signaling Pathways, Metabolism, Metabolism Of Lipids And Lipoproteins, Metabolism Processes, Pathways And Processes, Response To Hypoxia
company information
Boster
3942 B Valley Ave
Pleasanton, CA 94566
Pleasanton, CA 94566
boster@bosterbio.com
https://www.bosterbio.com925.485.4527
headquarters: USA
Premium Provider of Antibodies and ELISA Kits
questions and comments