Anti-14-3-3 zeta/delta/YWHAZ Antibody Picoband™ | Boster A01141-1 product information

This webpage contains legacy information. The product is either no longer available from the supplier or has been delisted at Labome.

product summary

company name :

Boster

product type :

antibody

product name :

Anti-14-3-3 zeta/delta/YWHAZ Antibody Picoband™

catalog :

A01141-1

quantity :

100µg/vial

clonality :

polyclonal

host :

domestic rabbit

conjugate :

nonconjugated

reactivity :

human, mouse, rat

application :

western blot, immunocytochemistry, flow cytometry, immunohistochemistry - paraffin section, immunohistochemistry - frozen section

product information

SKU :

A01141-1

Product Name :

Anti-14-3-3 zeta/delta/YWHAZ Antibody Picoband™

Size :

100µg/vial

Clonality :

Polyclonal

Host :

Rabbit

Reactivity :

Human, Mouse, Rat

Application(s) :

Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB

Application Details :

Western blot, 0.1-0.5µg/ml. Immunohistochemistry (Paraffin-embedded Section), 0.5-1µg/ml. Immunohistochemistry (Frozen Section), 0.5-1µg/ml, Human. Immunocytochemistry/Immunofluorescence, 2µg/ml. Flow Cytometry, 1-3µg/1x10^6 cells

Application Notes :

Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users.

Description :

Boster Bio Anti-14-3-3 zeta/delta/YWHAZ Antibody Picoband™ catalog # A01141-1. Tested in Flow Cytometry, IF, IHC-P, IHC-F, ICC, WB applications. This antibody reacts with Human, Mouse, Rat.

Concentration :

Adding 0.2 ml of distilled water will yield a concentration of 500 μg/ml.

Gene Name :

YWHAZ

Uniprot ID :

P63104

Immunogen :

(LLEKFLIPNASQAESKVFYLKMKGDYYRYLAEVAAGDD
KKGIVDQ).
A synthetic peptide corresponding to a sequence of human 14-3-3 zeta/delta

Form :

Lyophilized

Contents :

Each vial contains 4mg Trehalose, 0.9mg NaCl, 0.2mg Na 2 HPO 4 , 0.05mg NaN 3 .

Cross-reactivity :

No cross reactivity with other proteins.

Storage :

Store at -20˚C for one year from date of receipt. After reconstitution, at 4˚C for one month. It can also be aliquotted and stored frozen at -20˚C for six months. Avoid repeated freeze-thaw cycles.

Reconstitution :

Add 0.2ml of distilled water will yield a concentration of 500ug/ml.

Gene Full Name :

tyrosine 3-monooxygenase/tryptophan 5-monooxygenase activation protein zeta

Synonyms :

14-3-3 protein zeta/delta; Protein kinase C inhibitor protein 1; KCIP-1; YWHAZ

Protein Function :

Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner.

Subcellular Localization :

Cytoplasm

Recommended Detection Systems :

Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (EK1002) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (SV0002-1) for IHC(P), IHC(F) and ICC.

Background :

14-3-3 protein zeta/delta (14-3-3ζ) is a protein that in humans is encoded by the YWHAZ gene on chromosome 8. This gene product belongs to the 14-3-3 family of proteins which mediate signal transduction by binding to phosphoserine-containing proteins. This highly conserved protein family is found in both plants and mammals, and this protein is 99% identical to the mouse, rat and sheep orthologs. The encoded protein interacts with IRS1 protein, suggesting a role in regulating insulin sensitivity. Several transcript variants that differ in the 5' UTR but that encode the same protein have been identified for this gene.

Research Category :

Adapters, Alzheimer'S Disease, Apoptosis, Associated Proteins, Cell Biology, Cell Cycle, Cell Division, Cell Type Markers, Cytoplasmic, Intracellular, Neurodegenerative Disease, Neurology Process, Neuroscience, Signal Transduction, Tags & Cell Markers, Tumor Associated